Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Aryl hydrocarbon receptor nuclear translocator 2

Gene

Arnt2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Transcription factor that plays a role in the development of the hypothalamo-pituitary axis, postnatal brain growth, and visual and renal function. Specifically recognizes the xenobiotic response element (XRE).By similarity

GO - Molecular functioni

GO - Biological processi

  • brain development Source: UniProtKB
  • in utero embryonic development Source: Ensembl
  • negative regulation of apoptotic process Source: RGD
  • positive regulation of cell proliferation Source: RGD
  • response to estradiol Source: RGD
  • response to hypoxia Source: RGD
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Aryl hydrocarbon receptor nuclear translocator 2
Short name:
ARNT protein 2
Gene namesi
Name:Arnt2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 1

Organism-specific databases

RGDi2154. Arnt2.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

  • cytoplasm Source: InterPro
  • nucleus Source: RGD
  • transcription factor complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 712712Aryl hydrocarbon receptor nuclear translocator 2PRO_0000275900Add
BLAST

Proteomic databases

PaxDbiQ78E60.

PTM databases

iPTMnetiQ78E60.
PhosphoSiteiQ78E60.

Expressioni

Gene expression databases

ExpressionAtlasiQ78E60. baseline and differential.
GenevisibleiQ78E60. RN.

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Heterodimer with the aryl hydrocarbon receptor (AHR) or the SIM1 protein. Interacts with TACC3 (By similarity).By similarity

GO - Molecular functioni

  • protein heterodimerization activity Source: RGD

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000017636.

Structurei

3D structure databases

ProteinModelPortaliQ78E60.
SMRiQ78E60. Positions 328-438.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini63 – 11654bHLHPROSITE-ProRule annotationAdd
BLAST
Domaini134 – 20976PAS 1PROSITE-ProRule annotationAdd
BLAST
Domaini323 – 39371PAS 2PROSITE-ProRule annotationAdd
BLAST
Domaini398 – 44144PACAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi73 – 764Poly-Arg
Compositional biasi440 – 4456Poly-Gln
Compositional biasi552 – 5554Poly-Ser

Sequence similaritiesi

Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation
Contains 2 PAS (PER-ARNT-SIM) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410KD32. Eukaryota.
ENOG410XS5S. LUCA.
GeneTreeiENSGT00760000118788.
HOGENOMiHOG000234380.
HOVERGENiHBG000164.
InParanoidiQ78E60.
KOiK15589.
PhylomeDBiQ78E60.
TreeFamiTF319983.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR001067. Nuc_translocat.
IPR001610. PAC.
IPR000014. PAS.
IPR013767. PAS_fold.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
PF00989. PAS. 1 hit.
[Graphical view]
PRINTSiPR00785. NCTRNSLOCATR.
SMARTiSM00353. HLH. 1 hit.
SM00086. PAC. 1 hit.
SM00091. PAS. 2 hits.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
SSF55785. SSF55785. 4 hits.
TIGRFAMsiTIGR00229. sensory_box. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
PS50112. PAS. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q78E60-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATPAAVNPP EMASDIPGSV TLPVAPMAAT GQVRMAGAMP ARGGKRRSGM
60 70 80 90 100
DFDDEDGEGP SKFSRENHSE IERRRRNKMT QYITELSDMV PTCSALARKP
110 120 130 140 150
DKLTILRMAV SHMKSMRGTG NKSTDGAYKP SFLTEQELKH LILEAADGFL
160 170 180 190 200
FVVAAETGRV IYVSDSVTPV LNQPQSEWFG STLYEQVHPD DVEKLREQLC
210 220 230 240 250
TSENSMTGRI LDLKTGTVKK EGQQSSMRMC MGSRRSFICR MRCGNAPLDH
260 270 280 290 300
LPLNRITTMR KRFRNGLGPV KEGEAQYAVV HCTGYIKAWP PAGMSIPEED
310 320 330 340 350
ADVGQGSKYC LVAIGRLQVT SSPVCMDMSG MSVPTEFLSR HNSDGIITFV
360 370 380 390 400
DPRCISVIGY QPQDLLGKDI LEFCHPEDQS HLRESFQQVV KLKGQVLSVM
410 420 430 440 450
YRFRTKNREW LLIRTSSFTF QNPYSDEIEY VICTNTNVKQ LQQQQAELEV
460 470 480 490 500
HQRDGLSSYD LSQVPVPNLP TGVHEAGKPV EKADAIFSQE RDPRFAEMFA
510 520 530 540 550
GISASEKKMM SSASASGSQQ IYSQGSPFPA GHSGKAFSSS VVHVPGVNDI
560 570 580 590 600
QSSSSTGQNI SQISRQLNQG QVAWTGSRPP FPGQPSKTQS SAFGIGSSHP
610 620 630 640 650
YPADPSSYSP LSSPAASSPS GNAYPSLANR TPGFAESGQS GGQFQGRPSE
660 670 680 690 700
VWSQWQSQHH GQQSGEQHSH QQPGQTEVFQ DMLPMPGDPT QGTGNYNIED
710
FADLGMFPPF SE
Length:712
Mass (Da):77,958
Last modified:July 5, 2004 - v1
Checksum:i649A8AA41E120320
GO
Isoform 2 (identifier: Q78E60-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     681-712: DMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE → VNPASSAFS

Show »
Length:689
Mass (Da):75,333
Checksum:i4DC2F6B6886EB455
GO

Sequence cautioni

The sequence AAB05247.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti456 – 4561L → P in ABB17190 (PubMed:12684048).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei681 – 71232DMLPM…PPFSE → VNPASSAFS in isoform 2. 1 PublicationVSP_022690Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U61157 mRNA. Translation: AAB05247.1. Different initiation.
U61405 mRNA. Translation: AAB03666.1.
AY264366 mRNA. Translation: AAO89095.1.
DQ223732 mRNA. Translation: ABB17190.1.
RefSeqiNP_036913.3. NM_012781.3. [Q78E60-1]
XP_006229560.1. XM_006229498.2. [Q78E60-2]
UniGeneiRn.10518.

Genome annotation databases

EnsembliENSRNOT00000017636; ENSRNOP00000017636; ENSRNOG00000013017. [Q78E60-1]
GeneIDi25243.
KEGGirno:25243.
UCSCiRGD:2154. rat. [Q78E60-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U61157 mRNA. Translation: AAB05247.1. Different initiation.
U61405 mRNA. Translation: AAB03666.1.
AY264366 mRNA. Translation: AAO89095.1.
DQ223732 mRNA. Translation: ABB17190.1.
RefSeqiNP_036913.3. NM_012781.3. [Q78E60-1]
XP_006229560.1. XM_006229498.2. [Q78E60-2]
UniGeneiRn.10518.

3D structure databases

ProteinModelPortaliQ78E60.
SMRiQ78E60. Positions 328-438.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000017636.

PTM databases

iPTMnetiQ78E60.
PhosphoSiteiQ78E60.

Proteomic databases

PaxDbiQ78E60.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000017636; ENSRNOP00000017636; ENSRNOG00000013017. [Q78E60-1]
GeneIDi25243.
KEGGirno:25243.
UCSCiRGD:2154. rat. [Q78E60-1]

Organism-specific databases

CTDi9915.
RGDi2154. Arnt2.

Phylogenomic databases

eggNOGiENOG410KD32. Eukaryota.
ENOG410XS5S. LUCA.
GeneTreeiENSGT00760000118788.
HOGENOMiHOG000234380.
HOVERGENiHBG000164.
InParanoidiQ78E60.
KOiK15589.
PhylomeDBiQ78E60.
TreeFamiTF319983.

Miscellaneous databases

NextBioi605835.
PROiQ78E60.

Gene expression databases

ExpressionAtlasiQ78E60. baseline and differential.
GenevisibleiQ78E60. RN.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR001067. Nuc_translocat.
IPR001610. PAC.
IPR000014. PAS.
IPR013767. PAS_fold.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
PF00989. PAS. 1 hit.
[Graphical view]
PRINTSiPR00785. NCTRNSLOCATR.
SMARTiSM00353. HLH. 1 hit.
SM00086. PAC. 1 hit.
SM00091. PAS. 2 hits.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
SSF55785. SSF55785. 4 hits.
TIGRFAMsiTIGR00229. sensory_box. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
PS50112. PAS. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Nucleotide sequence of rat Arnt2."
    Drutel G.
    Submitted (JUN-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Sprague-Dawley.
  2. "Identification of novel splice variants of ARNT and ARNT2 in the rat."
    Korkalainen M., Tuomisto J., Pohjanvirta R.
    Biochem. Biophys. Res. Commun. 303:1095-1100(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: Long Evans.
  3. "Low potassium induces Arnt2 overexpression in cerebellar granule neurons."
    Linguang S., Wei Y., Yijun H., Wenfang C., Xingwen S., Pengxin Q., Guangmei Y.
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Sprague-Dawley.
    Tissue: Brain.

Entry informationi

Entry nameiARNT2_RAT
AccessioniPrimary (citable) accession number: Q78E60
Secondary accession number(s): Q30B64
, Q63643, Q63646, Q80T24
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: July 5, 2004
Last modified: January 20, 2016
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.