Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Aryl hydrocarbon receptor nuclear translocator 2

Gene

Arnt2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Transcription factor that plays a role in the development of the hypothalamo-pituitary axis, postnatal brain growth, and visual and renal function. Specifically recognizes the xenobiotic response element (XRE).By similarity

GO - Molecular functioni

GO - Biological processi

  • brain development Source: UniProtKB
  • in utero embryonic development Source: Ensembl
  • negative regulation of apoptotic process Source: RGD
  • positive regulation of cell proliferation Source: RGD
  • positive regulation of transcription by RNA polymerase II Source: UniProtKB
  • response to estradiol Source: RGD
  • response to hypoxia Source: RGD

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-RNO-211945 Phase I - Functionalization of compounds
R-RNO-211976 Endogenous sterols
R-RNO-211981 Xenobiotics
R-RNO-8937144 Aryl hydrocarbon receptor signalling

Names & Taxonomyi

Protein namesi
Recommended name:
Aryl hydrocarbon receptor nuclear translocator 2
Short name:
ARNT protein 2
Gene namesi
Name:Arnt2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 1

Organism-specific databases

RGDi2154 Arnt2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002759001 – 712Aryl hydrocarbon receptor nuclear translocator 2Add BLAST712

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei42Omega-N-methylarginineBy similarity1

Keywords - PTMi

Methylation

Proteomic databases

PaxDbiQ78E60
PRIDEiQ78E60

PTM databases

CarbonylDBiQ78E60
iPTMnetiQ78E60
PhosphoSitePlusiQ78E60

Expressioni

Gene expression databases

BgeeiENSRNOG00000013017
GenevisibleiQ78E60 RN

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein (By similarity). Heterodimer with NPAS4 (By similarity). Heterodimer with the aryl hydrocarbon receptor (AHR) or the SIM1 protein (By similarity). Interacts with TACC3 (By similarity).By similarity

GO - Molecular functioni

  • aryl hydrocarbon receptor binding Source: Ensembl
  • protein heterodimerization activity Source: RGD

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000017636

Structurei

3D structure databases

ProteinModelPortaliQ78E60
SMRiQ78E60
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini63 – 116bHLHPROSITE-ProRule annotationAdd BLAST54
Domaini134 – 209PAS 1PROSITE-ProRule annotationAdd BLAST76
Domaini323 – 393PAS 2PROSITE-ProRule annotationAdd BLAST71
Domaini398 – 441PACAdd BLAST44

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi73 – 76Poly-Arg4
Compositional biasi440 – 445Poly-Gln6
Compositional biasi552 – 555Poly-Ser4

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410KD32 Eukaryota
ENOG410XS5S LUCA
GeneTreeiENSGT00760000118788
HOGENOMiHOG000234380
HOVERGENiHBG000164
InParanoidiQ78E60
KOiK15589
OMAiIVEPQHY
OrthoDBiEOG091G03AI
PhylomeDBiQ78E60
TreeFamiTF319983

Family and domain databases

CDDicd00083 HLH, 1 hit
cd00130 PAS, 2 hits
Gene3Di4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR036638 HLH_DNA-bd_sf
IPR001067 Nuc_translocat
IPR001610 PAC
IPR000014 PAS
IPR035965 PAS-like_dom_sf
IPR013767 PAS_fold
PfamiView protein in Pfam
PF00010 HLH, 1 hit
PF00989 PAS, 1 hit
PRINTSiPR00785 NCTRNSLOCATR
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SM00086 PAC, 1 hit
SM00091 PAS, 2 hits
SUPFAMiSSF47459 SSF47459, 1 hit
SSF55785 SSF55785, 4 hits
TIGRFAMsiTIGR00229 sensory_box, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit
PS50112 PAS, 2 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q78E60-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATPAAVNPP EMASDIPGSV TLPVAPMAAT GQVRMAGAMP ARGGKRRSGM
60 70 80 90 100
DFDDEDGEGP SKFSRENHSE IERRRRNKMT QYITELSDMV PTCSALARKP
110 120 130 140 150
DKLTILRMAV SHMKSMRGTG NKSTDGAYKP SFLTEQELKH LILEAADGFL
160 170 180 190 200
FVVAAETGRV IYVSDSVTPV LNQPQSEWFG STLYEQVHPD DVEKLREQLC
210 220 230 240 250
TSENSMTGRI LDLKTGTVKK EGQQSSMRMC MGSRRSFICR MRCGNAPLDH
260 270 280 290 300
LPLNRITTMR KRFRNGLGPV KEGEAQYAVV HCTGYIKAWP PAGMSIPEED
310 320 330 340 350
ADVGQGSKYC LVAIGRLQVT SSPVCMDMSG MSVPTEFLSR HNSDGIITFV
360 370 380 390 400
DPRCISVIGY QPQDLLGKDI LEFCHPEDQS HLRESFQQVV KLKGQVLSVM
410 420 430 440 450
YRFRTKNREW LLIRTSSFTF QNPYSDEIEY VICTNTNVKQ LQQQQAELEV
460 470 480 490 500
HQRDGLSSYD LSQVPVPNLP TGVHEAGKPV EKADAIFSQE RDPRFAEMFA
510 520 530 540 550
GISASEKKMM SSASASGSQQ IYSQGSPFPA GHSGKAFSSS VVHVPGVNDI
560 570 580 590 600
QSSSSTGQNI SQISRQLNQG QVAWTGSRPP FPGQPSKTQS SAFGIGSSHP
610 620 630 640 650
YPADPSSYSP LSSPAASSPS GNAYPSLANR TPGFAESGQS GGQFQGRPSE
660 670 680 690 700
VWSQWQSQHH GQQSGEQHSH QQPGQTEVFQ DMLPMPGDPT QGTGNYNIED
710
FADLGMFPPF SE
Length:712
Mass (Da):77,958
Last modified:July 5, 2004 - v1
Checksum:i649A8AA41E120320
GO
Isoform 2 (identifier: Q78E60-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     681-712: DMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE → VNPASSAFS

Show »
Length:689
Mass (Da):75,333
Checksum:i4DC2F6B6886EB455
GO

Sequence cautioni

The sequence AAB05247 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti456L → P in ABB17190 (PubMed:12684048).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_022690681 – 712DMLPM…PPFSE → VNPASSAFS in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U61157 mRNA Translation: AAB05247.1 Different initiation.
U61405 mRNA Translation: AAB03666.1
AY264366 mRNA Translation: AAO89095.1
DQ223732 mRNA Translation: ABB17190.1
RefSeqiNP_036913.3, NM_012781.3 [Q78E60-1]
XP_006229560.1, XM_006229498.2 [Q78E60-2]
UniGeneiRn.10518

Genome annotation databases

EnsembliENSRNOT00000017636; ENSRNOP00000017636; ENSRNOG00000013017 [Q78E60-1]
GeneIDi25243
KEGGirno:25243
UCSCiRGD:2154 rat [Q78E60-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiARNT2_RAT
AccessioniPrimary (citable) accession number: Q78E60
Secondary accession number(s): Q30B64
, Q63643, Q63646, Q80T24
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: July 5, 2004
Last modified: May 23, 2018
This is version 103 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health