Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MTSS1-like protein

Gene

MTSS1L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May function in actin bundling.1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
MTSS1-like protein
Alternative name(s):
Actin-bundling with BAIAP2 homology protein 1
Short name:
ABBA-1
Gene namesi
Name:MTSS1L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:25094. MTSS1L.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164723215.

Polymorphism and mutation databases

BioMutaiMTSS1L.
DMDMi74727332.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 747747MTSS1-like proteinPRO_0000319610Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei441 – 4411Phosphoserine2 Publications
Modified residuei579 – 5791Phosphoserine1 Publication
Modified residuei601 – 6011Phosphoserine2 Publications
Modified residuei612 – 6121Phosphoserine1 Publication
Modified residuei624 – 6241Phosphoserine1 Publication
Modified residuei634 – 6341Phosphoserine1 Publication
Modified residuei639 – 6391Phosphoserine3 Publications
Modified residuei643 – 6431Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ765P7.
PaxDbiQ765P7.
PRIDEiQ765P7.

PTM databases

PhosphoSiteiQ765P7.

Expressioni

Gene expression databases

BgeeiQ765P7.
ExpressionAtlasiQ765P7. baseline and differential.
GenevisibleiQ765P7. HS.

Organism-specific databases

HPAiHPA048531.

Interactioni

Protein-protein interaction databases

BioGridi124914. 2 interactions.
IntActiQ765P7. 1 interaction.
STRINGi9606.ENSP00000341171.

Structurei

3D structure databases

ProteinModelPortaliQ765P7.
SMRiQ765P7. Positions 5-244.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 252252IMDPROSITE-ProRule annotationAdd
BLAST
Domaini719 – 73618WH2Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili135 – 15925Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi252 – 383132Ser-richAdd
BLAST

Sequence similaritiesi

Belongs to the MTSS1 family.Curated
Contains 1 IMD (IRSp53/MIM homology) domain.PROSITE-ProRule annotation
Contains 1 WH2 domain.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG72831.
GeneTreeiENSGT00390000002637.
HOGENOMiHOG000113691.
HOVERGENiHBG052530.
InParanoidiQ765P7.
OMAiAEKECGA.
OrthoDBiEOG7T7GSJ.
PhylomeDBiQ765P7.
TreeFamiTF320619.

Family and domain databases

InterProiIPR030059. ABBA.
IPR013606. I-BAR_dom.
IPR030127. MIM/ABBA.
[Graphical view]
PANTHERiPTHR15708. PTHR15708. 1 hit.
PTHR15708:SF8. PTHR15708:SF8. 1 hit.
PfamiPF08397. IMD. 1 hit.
[Graphical view]
PROSITEiPS51338. IMD. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q765P7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
METAEKECGA LGGLFQAIVN DMKSSYPIWE DFNSKATKLH SQLRTTVLAA
60 70 80 90 100
VAFLDAFQKV ADMATNTRGA TRDIGSALTR MCMRHRSIET KLRQFTNALL
110 120 130 140 150
ESLINPLQER IEDWKKAANQ LDKDHAKEYK RARHEIKKKS SDTLKLQKKA
160 170 180 190 200
RKELLGKGDL QPQLDSALQD VNDMYLLLEE TEKQAVRRAL IEERGRFCTF
210 220 230 240 250
ITFLQPVVNG ELTMLGEITH LQGIIDDLVV LTAEPHKLPP ASEQVIKDLK
260 270 280 290 300
GSDYSWSYQT PPSSPSSSSS RKSSMCSAPS SSSSAKGGGA PWPGGAQTYS
310 320 330 340 350
PSSTCRYRSL AQPATTTARL SSVSSHDSGF VSQDATYSKP PSPMPSDITS
360 370 380 390 400
QKSSSSASSE ASETCQSVSE CSSPTSDWSK VGSHEQPSGA TLQRRKDRVE
410 420 430 440 450
LLRDTEPGPA SGGTLGPSGE EAPRPRMSPA TIAAKHGEEV SPAASDLAMV
460 470 480 490 500
LTRGLSLEHQ KSSRDSLQYS SGYSTQTTTP SCSEDTIPSQ GSDYDCYSVN
510 520 530 540 550
GDADSEGPPE FDKSSTIPRN SNIAQNYRRL IQTKRPASTA GLPTAGLPTA
560 570 580 590 600
TGLPSGAPPG VATIRRTPST KPTVRRALSS AGPIPIRPPI VPVKTPTVPD
610 620 630 640 650
SPGYMGPTRA GSEECVFYTD ETASPLAPDL AKASPKRLSL PNTAWGSPSP
660 670 680 690 700
EAAGYPGAGA EDEQQQLAAN RHSLVEKLGE LVAGAHALGE GQFPFPTALS
710 720 730 740
ATPTEETPTP PPAATSDPPA EDMLVAIRRG VRLRRTVTND RSAPRIL
Length:747
Mass (Da):79,929
Last modified:July 5, 2004 - v1
Checksum:i9D0EEF31702E9736
GO
Isoform 2 (identifier: Q765P7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     153-155: Missing.
     264-294: SPSSSSSRKSSMCSAPSSSSSAKGGGAPWPG → VPSEPFVSFLSVRFWKNSPLLPAPSTPSSPI
     295-747: Missing.

Note: No experimental confirmation available.
Show »
Length:291
Mass (Da):32,799
Checksum:iCF46678FF8C4A83D
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei153 – 1553Missing in isoform 2. 1 PublicationVSP_031513
Alternative sequencei264 – 29431SPSSS…APWPG → VPSEPFVSFLSVRFWKNSPL LPAPSTPSSPI in isoform 2. 1 PublicationVSP_031514Add
BLAST
Alternative sequencei295 – 747453Missing in isoform 2. 1 PublicationVSP_031515Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB115770 mRNA. Translation: BAC98378.1.
AC020763 Genomic DNA. No translation available.
BC002770 mRNA. Translation: AAH02770.1.
CCDSiCCDS32476.1. [Q765P7-1]
RefSeqiNP_612392.1. NM_138383.2. [Q765P7-1]
UniGeneiHs.432387.

Genome annotation databases

EnsembliENST00000338779; ENSP00000341171; ENSG00000132613. [Q765P7-1]
GeneIDi92154.
KEGGihsa:92154.
UCSCiuc002ezj.3. human. [Q765P7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB115770 mRNA. Translation: BAC98378.1.
AC020763 Genomic DNA. No translation available.
BC002770 mRNA. Translation: AAH02770.1.
CCDSiCCDS32476.1. [Q765P7-1]
RefSeqiNP_612392.1. NM_138383.2. [Q765P7-1]
UniGeneiHs.432387.

3D structure databases

ProteinModelPortaliQ765P7.
SMRiQ765P7. Positions 5-244.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124914. 2 interactions.
IntActiQ765P7. 1 interaction.
STRINGi9606.ENSP00000341171.

PTM databases

PhosphoSiteiQ765P7.

Polymorphism and mutation databases

BioMutaiMTSS1L.
DMDMi74727332.

Proteomic databases

MaxQBiQ765P7.
PaxDbiQ765P7.
PRIDEiQ765P7.

Protocols and materials databases

DNASUi92154.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338779; ENSP00000341171; ENSG00000132613. [Q765P7-1]
GeneIDi92154.
KEGGihsa:92154.
UCSCiuc002ezj.3. human. [Q765P7-1]

Organism-specific databases

CTDi92154.
GeneCardsiGC16M070695.
HGNCiHGNC:25094. MTSS1L.
HPAiHPA048531.
neXtProtiNX_Q765P7.
PharmGKBiPA164723215.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG72831.
GeneTreeiENSGT00390000002637.
HOGENOMiHOG000113691.
HOVERGENiHBG052530.
InParanoidiQ765P7.
OMAiAEKECGA.
OrthoDBiEOG7T7GSJ.
PhylomeDBiQ765P7.
TreeFamiTF320619.

Miscellaneous databases

ChiTaRSiMTSS1L. human.
GenomeRNAii92154.
NextBioi77613.
PROiQ765P7.

Gene expression databases

BgeeiQ765P7.
ExpressionAtlasiQ765P7. baseline and differential.
GenevisibleiQ765P7. HS.

Family and domain databases

InterProiIPR030059. ABBA.
IPR013606. I-BAR_dom.
IPR030127. MIM/ABBA.
[Graphical view]
PANTHERiPTHR15708. PTHR15708. 1 hit.
PTHR15708:SF8. PTHR15708:SF8. 1 hit.
PfamiPF08397. IMD. 1 hit.
[Graphical view]
PROSITEiPS51338. IMD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A novel actin bundling/filopodium-forming domain conserved in insulin receptor tyrosine kinase substrate p53 and missing in metastasis protein."
    Yamagishi A., Masuda M., Ohki T., Onishi H., Mochizuki N.
    J. Biol. Chem. 279:14929-14936(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, DOMAIN.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 80-747 (ISOFORM 2).
    Tissue: Skin.
  4. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-601; SER-639 AND THR-643, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441; SER-579; SER-612; SER-624; SER-634 AND SER-639, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-601 AND SER-639, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiMTSSL_HUMAN
AccessioniPrimary (citable) accession number: Q765P7
Secondary accession number(s): A6NJI7, Q9BUA8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 5, 2004
Last modified: June 24, 2015
This is version 85 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.