Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q765P7

- MTSSL_HUMAN

UniProt

Q765P7 - MTSSL_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

MTSS1-like protein

Gene

MTSS1L

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

May function in actin bundling.1 Publication

GO - Biological processi

  1. filopodium assembly Source: InterPro
  2. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
MTSS1-like protein
Alternative name(s):
Actin-bundling with BAIAP2 homology protein 1
Short name:
ABBA-1
Gene namesi
Name:MTSS1L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:25094. MTSS1L.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164723215.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 747747MTSS1-like proteinPRO_0000319610Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei441 – 4411Phosphoserine2 Publications
Modified residuei579 – 5791Phosphoserine1 Publication
Modified residuei601 – 6011Phosphoserine1 Publication
Modified residuei612 – 6121Phosphoserine1 Publication
Modified residuei624 – 6241Phosphoserine1 Publication
Modified residuei634 – 6341Phosphoserine1 Publication
Modified residuei639 – 6391Phosphoserine2 Publications
Modified residuei643 – 6431Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ765P7.
PaxDbiQ765P7.
PRIDEiQ765P7.

PTM databases

PhosphoSiteiQ765P7.

Expressioni

Gene expression databases

BgeeiQ765P7.
GenevestigatoriQ765P7.

Organism-specific databases

HPAiHPA048531.

Interactioni

Protein-protein interaction databases

IntActiQ765P7. 1 interaction.
STRINGi9606.ENSP00000341171.

Structurei

3D structure databases

ProteinModelPortaliQ765P7.
SMRiQ765P7. Positions 5-244.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 252252IMDPROSITE-ProRule annotationAdd
BLAST
Domaini719 – 73618WH2Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili135 – 15925Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi252 – 383132Ser-richAdd
BLAST

Sequence similaritiesi

Belongs to the MTSS1 family.Curated
Contains 1 IMD (IRSp53/MIM homology) domain.PROSITE-ProRule annotation
Contains 1 WH2 domain.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG72831.
GeneTreeiENSGT00390000002637.
HOGENOMiHOG000113691.
HOVERGENiHBG052530.
InParanoidiQ765P7.
OMAiAEKECGA.
OrthoDBiEOG7T7GSJ.
PhylomeDBiQ765P7.
TreeFamiTF320619.

Family and domain databases

InterProiIPR013606. IRSp53/MIM_homology_IMD.
[Graphical view]
PfamiPF08397. IMD. 1 hit.
[Graphical view]
PROSITEiPS51338. IMD. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q765P7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
METAEKECGA LGGLFQAIVN DMKSSYPIWE DFNSKATKLH SQLRTTVLAA
60 70 80 90 100
VAFLDAFQKV ADMATNTRGA TRDIGSALTR MCMRHRSIET KLRQFTNALL
110 120 130 140 150
ESLINPLQER IEDWKKAANQ LDKDHAKEYK RARHEIKKKS SDTLKLQKKA
160 170 180 190 200
RKELLGKGDL QPQLDSALQD VNDMYLLLEE TEKQAVRRAL IEERGRFCTF
210 220 230 240 250
ITFLQPVVNG ELTMLGEITH LQGIIDDLVV LTAEPHKLPP ASEQVIKDLK
260 270 280 290 300
GSDYSWSYQT PPSSPSSSSS RKSSMCSAPS SSSSAKGGGA PWPGGAQTYS
310 320 330 340 350
PSSTCRYRSL AQPATTTARL SSVSSHDSGF VSQDATYSKP PSPMPSDITS
360 370 380 390 400
QKSSSSASSE ASETCQSVSE CSSPTSDWSK VGSHEQPSGA TLQRRKDRVE
410 420 430 440 450
LLRDTEPGPA SGGTLGPSGE EAPRPRMSPA TIAAKHGEEV SPAASDLAMV
460 470 480 490 500
LTRGLSLEHQ KSSRDSLQYS SGYSTQTTTP SCSEDTIPSQ GSDYDCYSVN
510 520 530 540 550
GDADSEGPPE FDKSSTIPRN SNIAQNYRRL IQTKRPASTA GLPTAGLPTA
560 570 580 590 600
TGLPSGAPPG VATIRRTPST KPTVRRALSS AGPIPIRPPI VPVKTPTVPD
610 620 630 640 650
SPGYMGPTRA GSEECVFYTD ETASPLAPDL AKASPKRLSL PNTAWGSPSP
660 670 680 690 700
EAAGYPGAGA EDEQQQLAAN RHSLVEKLGE LVAGAHALGE GQFPFPTALS
710 720 730 740
ATPTEETPTP PPAATSDPPA EDMLVAIRRG VRLRRTVTND RSAPRIL
Length:747
Mass (Da):79,929
Last modified:July 5, 2004 - v1
Checksum:i9D0EEF31702E9736
GO
Isoform 2 (identifier: Q765P7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     153-155: Missing.
     264-294: SPSSSSSRKSSMCSAPSSSSSAKGGGAPWPG → VPSEPFVSFLSVRFWKNSPLLPAPSTPSSPI
     295-747: Missing.

Note: No experimental confirmation available.

Show »
Length:291
Mass (Da):32,799
Checksum:iCF46678FF8C4A83D
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei153 – 1553Missing in isoform 2. 1 PublicationVSP_031513
Alternative sequencei264 – 29431SPSSS…APWPG → VPSEPFVSFLSVRFWKNSPL LPAPSTPSSPI in isoform 2. 1 PublicationVSP_031514Add
BLAST
Alternative sequencei295 – 747453Missing in isoform 2. 1 PublicationVSP_031515Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB115770 mRNA. Translation: BAC98378.1.
AC020763 Genomic DNA. No translation available.
BC002770 mRNA. Translation: AAH02770.1.
CCDSiCCDS32476.1. [Q765P7-1]
RefSeqiNP_612392.1. NM_138383.2. [Q765P7-1]
UniGeneiHs.432387.

Genome annotation databases

EnsembliENST00000338779; ENSP00000341171; ENSG00000132613. [Q765P7-1]
GeneIDi92154.
KEGGihsa:92154.
UCSCiuc002ezj.3. human. [Q765P7-1]

Polymorphism databases

DMDMi74727332.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB115770 mRNA. Translation: BAC98378.1 .
AC020763 Genomic DNA. No translation available.
BC002770 mRNA. Translation: AAH02770.1 .
CCDSi CCDS32476.1. [Q765P7-1 ]
RefSeqi NP_612392.1. NM_138383.2. [Q765P7-1 ]
UniGenei Hs.432387.

3D structure databases

ProteinModelPortali Q765P7.
SMRi Q765P7. Positions 5-244.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q765P7. 1 interaction.
STRINGi 9606.ENSP00000341171.

PTM databases

PhosphoSitei Q765P7.

Polymorphism databases

DMDMi 74727332.

Proteomic databases

MaxQBi Q765P7.
PaxDbi Q765P7.
PRIDEi Q765P7.

Protocols and materials databases

DNASUi 92154.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000338779 ; ENSP00000341171 ; ENSG00000132613 . [Q765P7-1 ]
GeneIDi 92154.
KEGGi hsa:92154.
UCSCi uc002ezj.3. human. [Q765P7-1 ]

Organism-specific databases

CTDi 92154.
GeneCardsi GC16M070695.
HGNCi HGNC:25094. MTSS1L.
HPAi HPA048531.
neXtProti NX_Q765P7.
PharmGKBi PA164723215.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG72831.
GeneTreei ENSGT00390000002637.
HOGENOMi HOG000113691.
HOVERGENi HBG052530.
InParanoidi Q765P7.
OMAi AEKECGA.
OrthoDBi EOG7T7GSJ.
PhylomeDBi Q765P7.
TreeFami TF320619.

Miscellaneous databases

ChiTaRSi MTSS1L. human.
GenomeRNAii 92154.
NextBioi 77613.
PROi Q765P7.

Gene expression databases

Bgeei Q765P7.
Genevestigatori Q765P7.

Family and domain databases

InterProi IPR013606. IRSp53/MIM_homology_IMD.
[Graphical view ]
Pfami PF08397. IMD. 1 hit.
[Graphical view ]
PROSITEi PS51338. IMD. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel actin bundling/filopodium-forming domain conserved in insulin receptor tyrosine kinase substrate p53 and missing in metastasis protein."
    Yamagishi A., Masuda M., Ohki T., Onishi H., Mochizuki N.
    J. Biol. Chem. 279:14929-14936(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, DOMAIN.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 80-747 (ISOFORM 2).
    Tissue: Skin.
  4. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-601; SER-639 AND THR-643, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441; SER-579; SER-612; SER-624; SER-634 AND SER-639, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiMTSSL_HUMAN
AccessioniPrimary (citable) accession number: Q765P7
Secondary accession number(s): A6NJI7, Q9BUA8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 5, 2004
Last modified: October 29, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3