Q765P7 (MTSSL_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: MTSS1-like protein Alternative name(s): Actin-bundling with BAIAP2 homology protein 1 Short name=ABBA-1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 747 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May function in actin bundling. Ref.1 |
| Sequence similarities | Belongs to the MTSS1 family. Contains 1 IMD (IRSp53/MIM homology) domain. Contains 1 WH2 domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Ligand | Actin-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | filopodium assembly Inferred from electronic annotation. Source: InterPro signal transductionInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q765P7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q765P7-2) The sequence of this isoform differs from the canonical sequence as follows: 153-155: Missing. 264-294: SPSSSSSRKSSMCSAPSSSSSAKGGGAPWPG → VPSEPFVSFLSVRFWKNSPLLPAPSTPSSPI 295-747: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 747 | 747 | MTSS1-like protein | PRO_0000319610 | |||||
Regions | |||||||||
| Domain | 1 – 252 | 252 | IMD | ||||||
| Domain | 719 – 736 | 18 | WH2 | ||||||
| Coiled coil | 135 – 159 | 25 | Potential | ||||||
| Compositional bias | 252 – 383 | 132 | Ser-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 260 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 264 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 441 | 1 | Phosphoserine Ref.5 Ref.7 | ||||||
| Modified residue | 456 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 579 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 601 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 612 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 624 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 634 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 639 | 1 | Phosphoserine Ref.4 Ref.5 | ||||||
| Modified residue | 643 | 1 | Phosphothreonine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 153 – 155 | 3 | Missing in isoform 2. | VSP_031513 | |||||
| Alternative sequence | 264 – 294 | 31 | SPSSS…APWPG → VPSEPFVSFLSVRFWKNSPL LPAPSTPSSPI in isoform 2. | VSP_031514 | |||||
| Alternative sequence | 295 – 747 | 453 | Missing in isoform 2. | VSP_031515 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel actin bundling/filopodium-forming domain conserved in insulin receptor tyrosine kinase substrate p53 and missing in metastasis protein." Yamagishi A., Masuda M., Ohki T., Onishi H., Mochizuki N. J. Biol. Chem. 279:14929-14936(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, DOMAIN. |
| [2] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 80-747 (ISOFORM 2). Tissue: Skin. |
| [4] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-601; SER-639 AND THR-643, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [5] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441; SER-579; SER-612; SER-624; SER-634 AND SER-639, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [7] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB115770 mRNA. Translation: BAC98378.1. AC020763 Genomic DNA. No translation available. BC002770 mRNA. Translation: AAH02770.1. |
| IPI | IPI00783109. IPI00884952. |
| RefSeq | NP_612392.1. NM_138383.2. |
| UniGene | Hs.432387. |
3D structure databases | |
| ProteinModelPortal | Q765P7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q765P7. 1 interaction. |
| STRING | 9606.ENSP00000341171. |
PTM databases | |
| PhosphoSite | Q765P7. |
Polymorphism databases | |
| DMDM | 74727332. |
Proteomic databases | |
| PaxDb | Q765P7. |
| PRIDE | Q765P7. |
Protocols and materials databases | |
| DNASU | 92154. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338779; ENSP00000341171; ENSG00000132613. |
| GeneID | 92154. |
| KEGG | hsa:92154. |
| UCSC | uc002ezj.3. human. uc002ezk.1. human. |
Organism-specific databases | |
| CTD | 92154. |
| GeneCards | GC16M070695. |
| HGNC | HGNC:25094. MTSS1L. |
| HPA | HPA048531. |
| neXtProt | NX_Q765P7. |
| PharmGKB | PA164723215. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG72831. |
| HOGENOM | HOG000113691. |
| HOVERGEN | HBG052530. |
| InParanoid | Q765P7. |
| OMA | YVGPTRA. |
| OrthoDB | EOG4JHCFB. |
Gene expression databases | |
| Bgee | Q765P7. |
| Genevestigator | Q765P7. |
Family and domain databases | |
| InterPro | IPR013606. IRSp53/MIM_homology_IMD. [Graphical view] |
| Pfam | PF08397. IMD. 1 hit. [Graphical view] |
| PROSITE | PS51338. IMD. 1 hit. PS51082. WH2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MTSS1L. human. |
| GenomeRNAi | 92154. |
| NextBio | 77613. |
Entry information
| Entry name | MTSSL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q765P7 Secondary accession number(s): A6NJI7, Q9BUA8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
