Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q765P7

- MTSSL_HUMAN

UniProt

Q765P7 - MTSSL_HUMAN

Protein

MTSS1-like protein

Gene

MTSS1L

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 78 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May function in actin bundling.1 Publication

    GO - Biological processi

    1. filopodium assembly Source: InterPro
    2. signal transduction Source: InterPro

    Keywords - Ligandi

    Actin-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    MTSS1-like protein
    Alternative name(s):
    Actin-bundling with BAIAP2 homology protein 1
    Short name:
    ABBA-1
    Gene namesi
    Name:MTSS1L
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:25094. MTSS1L.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164723215.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 747747MTSS1-like proteinPRO_0000319610Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei441 – 4411Phosphoserine2 Publications
    Modified residuei579 – 5791Phosphoserine1 Publication
    Modified residuei601 – 6011Phosphoserine1 Publication
    Modified residuei612 – 6121Phosphoserine1 Publication
    Modified residuei624 – 6241Phosphoserine1 Publication
    Modified residuei634 – 6341Phosphoserine1 Publication
    Modified residuei639 – 6391Phosphoserine2 Publications
    Modified residuei643 – 6431Phosphothreonine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ765P7.
    PaxDbiQ765P7.
    PRIDEiQ765P7.

    PTM databases

    PhosphoSiteiQ765P7.

    Expressioni

    Gene expression databases

    BgeeiQ765P7.
    GenevestigatoriQ765P7.

    Organism-specific databases

    HPAiHPA048531.

    Interactioni

    Protein-protein interaction databases

    IntActiQ765P7. 1 interaction.
    STRINGi9606.ENSP00000341171.

    Structurei

    3D structure databases

    ProteinModelPortaliQ765P7.
    SMRiQ765P7. Positions 5-244.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 252252IMDPROSITE-ProRule annotationAdd
    BLAST
    Domaini719 – 73618WH2Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili135 – 15925Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi252 – 383132Ser-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the MTSS1 family.Curated
    Contains 1 IMD (IRSp53/MIM homology) domain.PROSITE-ProRule annotation
    Contains 1 WH2 domain.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG72831.
    HOGENOMiHOG000113691.
    HOVERGENiHBG052530.
    InParanoidiQ765P7.
    OMAiAEKECGA.
    OrthoDBiEOG7T7GSJ.
    PhylomeDBiQ765P7.
    TreeFamiTF320619.

    Family and domain databases

    InterProiIPR013606. IRSp53/MIM_homology_IMD.
    [Graphical view]
    PfamiPF08397. IMD. 1 hit.
    [Graphical view]
    PROSITEiPS51338. IMD. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q765P7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    METAEKECGA LGGLFQAIVN DMKSSYPIWE DFNSKATKLH SQLRTTVLAA    50
    VAFLDAFQKV ADMATNTRGA TRDIGSALTR MCMRHRSIET KLRQFTNALL 100
    ESLINPLQER IEDWKKAANQ LDKDHAKEYK RARHEIKKKS SDTLKLQKKA 150
    RKELLGKGDL QPQLDSALQD VNDMYLLLEE TEKQAVRRAL IEERGRFCTF 200
    ITFLQPVVNG ELTMLGEITH LQGIIDDLVV LTAEPHKLPP ASEQVIKDLK 250
    GSDYSWSYQT PPSSPSSSSS RKSSMCSAPS SSSSAKGGGA PWPGGAQTYS 300
    PSSTCRYRSL AQPATTTARL SSVSSHDSGF VSQDATYSKP PSPMPSDITS 350
    QKSSSSASSE ASETCQSVSE CSSPTSDWSK VGSHEQPSGA TLQRRKDRVE 400
    LLRDTEPGPA SGGTLGPSGE EAPRPRMSPA TIAAKHGEEV SPAASDLAMV 450
    LTRGLSLEHQ KSSRDSLQYS SGYSTQTTTP SCSEDTIPSQ GSDYDCYSVN 500
    GDADSEGPPE FDKSSTIPRN SNIAQNYRRL IQTKRPASTA GLPTAGLPTA 550
    TGLPSGAPPG VATIRRTPST KPTVRRALSS AGPIPIRPPI VPVKTPTVPD 600
    SPGYMGPTRA GSEECVFYTD ETASPLAPDL AKASPKRLSL PNTAWGSPSP 650
    EAAGYPGAGA EDEQQQLAAN RHSLVEKLGE LVAGAHALGE GQFPFPTALS 700
    ATPTEETPTP PPAATSDPPA EDMLVAIRRG VRLRRTVTND RSAPRIL 747
    Length:747
    Mass (Da):79,929
    Last modified:July 5, 2004 - v1
    Checksum:i9D0EEF31702E9736
    GO
    Isoform 2 (identifier: Q765P7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         153-155: Missing.
         264-294: SPSSSSSRKSSMCSAPSSSSSAKGGGAPWPG → VPSEPFVSFLSVRFWKNSPLLPAPSTPSSPI
         295-747: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:291
    Mass (Da):32,799
    Checksum:iCF46678FF8C4A83D
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei153 – 1553Missing in isoform 2. 1 PublicationVSP_031513
    Alternative sequencei264 – 29431SPSSS…APWPG → VPSEPFVSFLSVRFWKNSPL LPAPSTPSSPI in isoform 2. 1 PublicationVSP_031514Add
    BLAST
    Alternative sequencei295 – 747453Missing in isoform 2. 1 PublicationVSP_031515Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB115770 mRNA. Translation: BAC98378.1.
    AC020763 Genomic DNA. No translation available.
    BC002770 mRNA. Translation: AAH02770.1.
    CCDSiCCDS32476.1. [Q765P7-1]
    RefSeqiNP_612392.1. NM_138383.2. [Q765P7-1]
    UniGeneiHs.432387.

    Genome annotation databases

    EnsembliENST00000338779; ENSP00000341171; ENSG00000132613. [Q765P7-1]
    GeneIDi92154.
    KEGGihsa:92154.
    UCSCiuc002ezj.3. human. [Q765P7-1]

    Polymorphism databases

    DMDMi74727332.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB115770 mRNA. Translation: BAC98378.1 .
    AC020763 Genomic DNA. No translation available.
    BC002770 mRNA. Translation: AAH02770.1 .
    CCDSi CCDS32476.1. [Q765P7-1 ]
    RefSeqi NP_612392.1. NM_138383.2. [Q765P7-1 ]
    UniGenei Hs.432387.

    3D structure databases

    ProteinModelPortali Q765P7.
    SMRi Q765P7. Positions 5-244.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q765P7. 1 interaction.
    STRINGi 9606.ENSP00000341171.

    PTM databases

    PhosphoSitei Q765P7.

    Polymorphism databases

    DMDMi 74727332.

    Proteomic databases

    MaxQBi Q765P7.
    PaxDbi Q765P7.
    PRIDEi Q765P7.

    Protocols and materials databases

    DNASUi 92154.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000338779 ; ENSP00000341171 ; ENSG00000132613 . [Q765P7-1 ]
    GeneIDi 92154.
    KEGGi hsa:92154.
    UCSCi uc002ezj.3. human. [Q765P7-1 ]

    Organism-specific databases

    CTDi 92154.
    GeneCardsi GC16M070695.
    HGNCi HGNC:25094. MTSS1L.
    HPAi HPA048531.
    neXtProti NX_Q765P7.
    PharmGKBi PA164723215.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG72831.
    HOGENOMi HOG000113691.
    HOVERGENi HBG052530.
    InParanoidi Q765P7.
    OMAi AEKECGA.
    OrthoDBi EOG7T7GSJ.
    PhylomeDBi Q765P7.
    TreeFami TF320619.

    Miscellaneous databases

    ChiTaRSi MTSS1L. human.
    GenomeRNAii 92154.
    NextBioi 77613.
    PROi Q765P7.

    Gene expression databases

    Bgeei Q765P7.
    Genevestigatori Q765P7.

    Family and domain databases

    InterProi IPR013606. IRSp53/MIM_homology_IMD.
    [Graphical view ]
    Pfami PF08397. IMD. 1 hit.
    [Graphical view ]
    PROSITEi PS51338. IMD. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel actin bundling/filopodium-forming domain conserved in insulin receptor tyrosine kinase substrate p53 and missing in metastasis protein."
      Yamagishi A., Masuda M., Ohki T., Onishi H., Mochizuki N.
      J. Biol. Chem. 279:14929-14936(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION, DOMAIN.
    2. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 80-747 (ISOFORM 2).
      Tissue: Skin.
    4. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-601; SER-639 AND THR-643, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441; SER-579; SER-612; SER-624; SER-634 AND SER-639, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiMTSSL_HUMAN
    AccessioniPrimary (citable) accession number: Q765P7
    Secondary accession number(s): A6NJI7, Q9BUA8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 26, 2008
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 78 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3