Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q70Z44

- 5HT3D_HUMAN

UniProt

Q70Z44 - 5HT3D_HUMAN

Protein

5-hydroxytryptamine receptor 3D

Gene

HTR3D

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 3 (28 Jun 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

    GO - Molecular functioni

    1. extracellular ligand-gated ion channel activity Source: InterPro

    GO - Biological processi

    1. ion transmembrane transport Source: Reactome
    2. transmembrane transport Source: Reactome

    Keywords - Molecular functioni

    Ion channel, Ligand-gated ion channel, Receptor

    Keywords - Biological processi

    Ion transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_25387. Ligand-gated ion channel transport.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    5-hydroxytryptamine receptor 3D
    Short name:
    5-HT3-D
    Short name:
    5-HT3D
    Alternative name(s):
    Serotonin receptor 3D
    Gene namesi
    Name:HTR3D
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:24004. HTR3D.

    Subcellular locationi

    Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication
    Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134866755.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Sequence AnalysisAdd
    BLAST
    Chaini25 – 4544305-hydroxytryptamine receptor 3DPRO_0000312293Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi66 – 661N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ70Z44.
    PRIDEiQ70Z44.

    Expressioni

    Tissue specificityi

    Expressed in liver, as well as fetal and adult colon and kidney.1 Publication

    Gene expression databases

    CleanExiHS_HTR3D.
    GenevestigatoriQ70Z44.

    Interactioni

    Subunit structurei

    Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.1 Publication

    Protein-protein interaction databases

    STRINGi9606.ENSP00000405409.

    Structurei

    3D structure databases

    ProteinModelPortaliQ70Z44.
    SMRiQ70Z44. Positions 51-322.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini25 – 232208ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini254 – 26411CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini286 – 30621ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini328 – 431104CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini453 – 4542ExtracellularSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei233 – 25321Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei265 – 28521Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei307 – 32721Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei432 – 45221Helical; Name=4Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG302603.
    HOGENOMiHOG000241519.
    HOVERGENiHBG106638.
    InParanoidiQ70Z44.
    KOiK04819.
    OMAiTEIFLFR.
    PhylomeDBiQ70Z44.
    TreeFamiTF315605.

    Family and domain databases

    Gene3Di1.20.120.370. 1 hit.
    2.70.170.10. 1 hit.
    InterProiIPR027361. Acetylcholine_rcpt_TM.
    IPR006202. Neur_chan_lig-bd.
    IPR006201. Neur_channel.
    IPR006029. Neurotrans-gated_channel_TM.
    [Graphical view]
    PANTHERiPTHR18945. PTHR18945. 1 hit.
    PfamiPF02931. Neur_chan_LBD. 1 hit.
    PF02932. Neur_chan_memb. 1 hit.
    [Graphical view]
    SUPFAMiSSF63712. SSF63712. 1 hit.
    SSF90112. SSF90112. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q70Z44-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQKHSPGPPA LALLSQSLLT TGNGDTLIIN CPGFGQHRVD PAAFQAVFDR    50
    KAIGPVTNYS VATHVNISFT LSAIWNCYSR IHTFNCHHAR PWHNQFVQWN 100
    PDECGGIKKS GMATENLWLS DVFIEESVDQ TPAGLMASMS IVKATSNTIS 150
    QCGWSASANW TPSISPSMDR ARAWRRMSRS FQIHHRTSFR TRREWVLLGI 200
    QKRTIKVTVA TNQYEQAIFH VAIRRRCRPS PYVVNFLVPS GILIAIDALS 250
    FYLPLESGNC APFKMTVLLG YSVFLLMMND LLPATSTSSH ASLVAPLALM 300
    QTPLPAGVYF ALCLSLMVGS LLETIFITHL LHVATTQPLP LPRWLHSLLL 350
    HCTGQGRCCP TAPQKGNKGP GLTPTHLPGV KEPEVSAGQM PGPGEAELTG 400
    GSEWTRAQRE HEAQKQHSVE LWVQFSHAMD ALLFRLYLLF MASSIITVIC 450
    LWNT 454
    Length:454
    Mass (Da):50,191
    Last modified:June 28, 2011 - v3
    Checksum:i8B12F6CC31C4446C
    GO
    Isoform 2 (identifier: Q70Z44-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-135: Missing.
         172-220: RAWRRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFH → ERSPSALSPTQ
         295-306: APLALMQTPLPA → RPHPSRDQKR

    Show »
    Length:279
    Mass (Da):30,477
    Checksum:i6B896347F37E902A
    GO
    Isoform 3 (identifier: Q70Z44-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-219: Missing.
         220-220: H → M
         295-306: APLALMQTPLPA → RPHPSRDQKR

    Show »
    Length:233
    Mass (Da):25,697
    Checksum:iCFAF7256BA7195EE
    GO
    Isoform 4 (identifier: Q70Z44-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-37: MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQH → MERGWFHGKGFLLGFILHLLLQDSHLQLVTSFLWLNM
         38-98: Missing.
         171-171: A → GERSPSALSPTQVT
         295-306: APLALMQTPLPA → RPHPSRDQKR

    Note: No experimental confirmation available.

    Show »
    Length:404
    Mass (Da):45,145
    Checksum:i6EE0A9AE03DF8694
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti155 – 1551S → P in AAI01092. (PubMed:15489334)Curated
    Sequence conflicti368 – 3681K → R in AAO38166. (PubMed:17392525)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti171 – 1711A → G.1 Publication
    Corresponds to variant rs6443930 [ dbSNP | Ensembl ].
    VAR_037478
    Natural varianti225 – 2251R → H.1 Publication
    Corresponds to variant rs1000952 [ dbSNP | Ensembl ].
    VAR_037479
    Natural varianti435 – 4351R → H.1 Publication
    Corresponds to variant rs6789754 [ dbSNP | Ensembl ].
    VAR_037480

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 219219Missing in isoform 3. 1 PublicationVSP_029797Add
    BLAST
    Alternative sequencei1 – 135135Missing in isoform 2. 2 PublicationsVSP_029798Add
    BLAST
    Alternative sequencei1 – 3737MQKHS…GFGQH → MERGWFHGKGFLLGFILHLL LQDSHLQLVTSFLWLNM in isoform 4. CuratedVSP_044828Add
    BLAST
    Alternative sequencei38 – 9861Missing in isoform 4. CuratedVSP_044829Add
    BLAST
    Alternative sequencei171 – 1711A → GERSPSALSPTQVT in isoform 4. CuratedVSP_044830
    Alternative sequencei172 – 22049RAWRR…QAIFH → ERSPSALSPTQ in isoform 2. 2 PublicationsVSP_029799Add
    BLAST
    Alternative sequencei220 – 2201H → M in isoform 3. 1 PublicationVSP_029800
    Alternative sequencei295 – 30612APLAL…TPLPA → RPHPSRDQKR in isoform 2, isoform 3 and isoform 4. 2 PublicationsVSP_029801Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ437318 mRNA. Translation: CAD24817.1.
    AY159812 mRNA. Translation: AAO38166.2.
    AC068644 Genomic DNA. No translation available.
    AC131235 Genomic DNA. No translation available.
    BC101090 mRNA. Translation: AAI01091.1.
    BC101091 mRNA. Translation: AAI01092.1.
    CCDSiCCDS3249.1. [Q70Z44-2]
    CCDS46966.1. [Q70Z44-4]
    CCDS54685.1. [Q70Z44-1]
    RefSeqiNP_001138615.1. NM_001145143.1. [Q70Z44-4]
    NP_001157118.1. NM_001163646.1. [Q70Z44-1]
    NP_872343.2. NM_182537.2.
    UniGeneiHs.448004.

    Genome annotation databases

    EnsembliENST00000382489; ENSP00000371929; ENSG00000186090. [Q70Z44-1]
    ENST00000428798; ENSP00000405409; ENSG00000186090. [Q70Z44-4]
    ENST00000453435; ENSP00000389268; ENSG00000186090. [Q70Z44-3]
    GeneIDi200909.
    KEGGihsa:200909.
    UCSCiuc010hxp.3. human. [Q70Z44-3]
    uc011bqv.2. human. [Q70Z44-1]

    Polymorphism databases

    DMDMi338817899.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ437318 mRNA. Translation: CAD24817.1 .
    AY159812 mRNA. Translation: AAO38166.2 .
    AC068644 Genomic DNA. No translation available.
    AC131235 Genomic DNA. No translation available.
    BC101090 mRNA. Translation: AAI01091.1 .
    BC101091 mRNA. Translation: AAI01092.1 .
    CCDSi CCDS3249.1. [Q70Z44-2 ]
    CCDS46966.1. [Q70Z44-4 ]
    CCDS54685.1. [Q70Z44-1 ]
    RefSeqi NP_001138615.1. NM_001145143.1. [Q70Z44-4 ]
    NP_001157118.1. NM_001163646.1. [Q70Z44-1 ]
    NP_872343.2. NM_182537.2.
    UniGenei Hs.448004.

    3D structure databases

    ProteinModelPortali Q70Z44.
    SMRi Q70Z44. Positions 51-322.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000405409.

    Chemistry

    BindingDBi Q70Z44.
    ChEMBLi CHEMBL2094132.
    DrugBanki DB01049. Ergoloid mesylate.
    GuidetoPHARMACOLOGYi 376.

    Polymorphism databases

    DMDMi 338817899.

    Proteomic databases

    PaxDbi Q70Z44.
    PRIDEi Q70Z44.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000382489 ; ENSP00000371929 ; ENSG00000186090 . [Q70Z44-1 ]
    ENST00000428798 ; ENSP00000405409 ; ENSG00000186090 . [Q70Z44-4 ]
    ENST00000453435 ; ENSP00000389268 ; ENSG00000186090 . [Q70Z44-3 ]
    GeneIDi 200909.
    KEGGi hsa:200909.
    UCSCi uc010hxp.3. human. [Q70Z44-3 ]
    uc011bqv.2. human. [Q70Z44-1 ]

    Organism-specific databases

    CTDi 200909.
    GeneCardsi GC03P183749.
    HGNCi HGNC:24004. HTR3D.
    MIMi 610122. gene.
    neXtProti NX_Q70Z44.
    PharmGKBi PA134866755.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG302603.
    HOGENOMi HOG000241519.
    HOVERGENi HBG106638.
    InParanoidi Q70Z44.
    KOi K04819.
    OMAi TEIFLFR.
    PhylomeDBi Q70Z44.
    TreeFami TF315605.

    Enzyme and pathway databases

    Reactomei REACT_25387. Ligand-gated ion channel transport.

    Miscellaneous databases

    GeneWikii HTR3D.
    GenomeRNAii 200909.
    NextBioi 35537460.
    PROi Q70Z44.
    SOURCEi Search...

    Gene expression databases

    CleanExi HS_HTR3D.
    Genevestigatori Q70Z44.

    Family and domain databases

    Gene3Di 1.20.120.370. 1 hit.
    2.70.170.10. 1 hit.
    InterProi IPR027361. Acetylcholine_rcpt_TM.
    IPR006202. Neur_chan_lig-bd.
    IPR006201. Neur_channel.
    IPR006029. Neurotrans-gated_channel_TM.
    [Graphical view ]
    PANTHERi PTHR18945. PTHR18945. 1 hit.
    Pfami PF02931. Neur_chan_LBD. 1 hit.
    PF02932. Neur_chan_memb. 1 hit.
    [Graphical view ]
    SUPFAMi SSF63712. SSF63712. 1 hit.
    SSF90112. SSF90112. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, physical mapping and expression analysis of the human 5-HT3 serotonin receptor-like genes HTR3C, HTR3D and HTR3E."
      Niesler B., Frank B., Kapeller J., Rappold G.A.
      Gene 310:101-111(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. "Characterization of the novel human serotonin receptor subunits 5-HT3C, 5-HT3D, and 5-HT3E."
      Niesler B., Walstab J., Combrink S., Moeller D., Kapeller J., Rietdorf J., Boenisch H., Goethert M., Rappold G., Bruess M.
      Mol. Pharmacol. 72:8-17(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBUNIT, SUBCELLULAR LOCATION, VARIANT GLY-171.
    3. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANTS HIS-225 AND HIS-435.

    Entry informationi

    Entry namei5HT3D_HUMAN
    AccessioniPrimary (citable) accession number: Q70Z44
    Secondary accession number(s): C9J2I6
    , J3QT78, Q495N5, Q495N6, Q7Z6B3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 4, 2007
    Last sequence update: June 28, 2011
    Last modified: October 1, 2014
    This is version 100 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3