Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5-hydroxytryptamine receptor 3D

Gene

HTR3D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

BioCyciZFISH:G66-32385-MONOMER.
ReactomeiR-HSA-975298. Ligand-gated ion channel transport.

Protein family/group databases

TCDBi1.A.9.2.3. the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family.

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 3D
Short name:
5-HT3-D
Short name:
5-HT3D
Alternative name(s):
Serotonin receptor 3D
Gene namesi
Name:HTR3D
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:24004. HTR3D.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini25 – 232ExtracellularSequence analysisAdd BLAST208
Transmembranei233 – 253Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini254 – 264CytoplasmicSequence analysisAdd BLAST11
Transmembranei265 – 285Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini286 – 306ExtracellularSequence analysisAdd BLAST21
Transmembranei307 – 327Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini328 – 431CytoplasmicSequence analysisAdd BLAST104
Transmembranei432 – 452Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini453 – 454ExtracellularSequence analysis2

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi200909.
OpenTargetsiENSG00000186090.
PharmGKBiPA134866755.

Chemistry databases

ChEMBLiCHEMBL2094132.
DrugBankiDB01049. Ergoloid mesylate.
DB00898. Ethanol.

Polymorphism and mutation databases

BioMutaiHTR3D.
DMDMi338817899.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Sequence analysisAdd BLAST24
ChainiPRO_000031229325 – 4545-hydroxytryptamine receptor 3DAdd BLAST430

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi66N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ70Z44.
PeptideAtlasiQ70Z44.
PRIDEiQ70Z44.

PTM databases

iPTMnetiQ70Z44.
PhosphoSitePlusiQ70Z44.

Expressioni

Tissue specificityi

Expressed in liver, as well as fetal and adult colon and kidney.1 Publication

Gene expression databases

CleanExiHS_HTR3D.
ExpressionAtlasiQ70Z44. baseline and differential.

Interactioni

Subunit structurei

Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
HTR3AP460985EBI-9008717,EBI-9008743

Protein-protein interaction databases

BioGridi128355. 3 interactors.
IntActiQ70Z44. 1 interactor.
STRINGi9606.ENSP00000371929.

Chemistry databases

BindingDBiQ70Z44.

Structurei

3D structure databases

ProteinModelPortaliQ70Z44.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3645. Eukaryota.
ENOG410XQGR. LUCA.
GeneTreeiENSGT00790000122957.
HOGENOMiHOG000241519.
HOVERGENiHBG106638.
InParanoidiQ70Z44.
KOiK04819.
OMAiFRAREWV.
OrthoDBiEOG091G0DE5.
PhylomeDBiQ70Z44.
TreeFamiTF315605.

Family and domain databases

Gene3Di1.20.120.370. 1 hit.
2.70.170.10. 1 hit.
InterProiIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
[Graphical view]
PANTHERiPTHR18945. PTHR18945. 1 hit.
PfamiPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view]
SUPFAMiSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q70Z44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQKHSPGPPA LALLSQSLLT TGNGDTLIIN CPGFGQHRVD PAAFQAVFDR
60 70 80 90 100
KAIGPVTNYS VATHVNISFT LSAIWNCYSR IHTFNCHHAR PWHNQFVQWN
110 120 130 140 150
PDECGGIKKS GMATENLWLS DVFIEESVDQ TPAGLMASMS IVKATSNTIS
160 170 180 190 200
QCGWSASANW TPSISPSMDR ARAWRRMSRS FQIHHRTSFR TRREWVLLGI
210 220 230 240 250
QKRTIKVTVA TNQYEQAIFH VAIRRRCRPS PYVVNFLVPS GILIAIDALS
260 270 280 290 300
FYLPLESGNC APFKMTVLLG YSVFLLMMND LLPATSTSSH ASLVAPLALM
310 320 330 340 350
QTPLPAGVYF ALCLSLMVGS LLETIFITHL LHVATTQPLP LPRWLHSLLL
360 370 380 390 400
HCTGQGRCCP TAPQKGNKGP GLTPTHLPGV KEPEVSAGQM PGPGEAELTG
410 420 430 440 450
GSEWTRAQRE HEAQKQHSVE LWVQFSHAMD ALLFRLYLLF MASSIITVIC

LWNT
Length:454
Mass (Da):50,191
Last modified:June 28, 2011 - v3
Checksum:i8B12F6CC31C4446C
GO
Isoform 2 (identifier: Q70Z44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-135: Missing.
     172-220: RAWRRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFH → ERSPSALSPTQ
     295-306: APLALMQTPLPA → RPHPSRDQKR

Show »
Length:279
Mass (Da):30,477
Checksum:i6B896347F37E902A
GO
Isoform 3 (identifier: Q70Z44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-219: Missing.
     220-220: H → M
     295-306: APLALMQTPLPA → RPHPSRDQKR

Show »
Length:233
Mass (Da):25,697
Checksum:iCFAF7256BA7195EE
GO
Isoform 4 (identifier: Q70Z44-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQH → MERGWFHGKGFLLGFILHLLLQDSHLQLVTSFLWLNM
     38-98: Missing.
     171-171: A → GERSPSALSPTQVT
     295-306: APLALMQTPLPA → RPHPSRDQKR

Note: No experimental confirmation available.
Show »
Length:404
Mass (Da):45,145
Checksum:i6EE0A9AE03DF8694
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti155S → P in AAI01092 (PubMed:15489334).Curated1
Sequence conflicti368K → R in AAO38166 (PubMed:17392525).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037478171A → G.1 PublicationCorresponds to variant rs6443930dbSNPEnsembl.1
Natural variantiVAR_037479225R → H.1 PublicationCorresponds to variant rs1000952dbSNPEnsembl.1
Natural variantiVAR_037480435R → H.1 PublicationCorresponds to variant rs6789754dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0297971 – 219Missing in isoform 3. 1 PublicationAdd BLAST219
Alternative sequenceiVSP_0297981 – 135Missing in isoform 2. 2 PublicationsAdd BLAST135
Alternative sequenceiVSP_0448281 – 37MQKHS…GFGQH → MERGWFHGKGFLLGFILHLL LQDSHLQLVTSFLWLNM in isoform 4. CuratedAdd BLAST37
Alternative sequenceiVSP_04482938 – 98Missing in isoform 4. CuratedAdd BLAST61
Alternative sequenceiVSP_044830171A → GERSPSALSPTQVT in isoform 4. Curated1
Alternative sequenceiVSP_029799172 – 220RAWRR…QAIFH → ERSPSALSPTQ in isoform 2. 2 PublicationsAdd BLAST49
Alternative sequenceiVSP_029800220H → M in isoform 3. 1 Publication1
Alternative sequenceiVSP_029801295 – 306APLAL…TPLPA → RPHPSRDQKR in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ437318 mRNA. Translation: CAD24817.1.
AY159812 mRNA. Translation: AAO38166.2.
AC068644 Genomic DNA. No translation available.
AC131235 Genomic DNA. No translation available.
BC101090 mRNA. Translation: AAI01091.1.
BC101091 mRNA. Translation: AAI01092.1.
CCDSiCCDS3249.1. [Q70Z44-2]
CCDS46966.1. [Q70Z44-4]
CCDS54685.1. [Q70Z44-1]
RefSeqiNP_001138615.1. NM_001145143.1. [Q70Z44-4]
NP_001157118.1. NM_001163646.1. [Q70Z44-1]
NP_872343.2. NM_182537.2.
XP_016861343.1. XM_017005854.1. [Q70Z44-3]
UniGeneiHs.448004.

Genome annotation databases

EnsembliENST00000382489; ENSP00000371929; ENSG00000186090. [Q70Z44-1]
ENST00000428798; ENSP00000405409; ENSG00000186090. [Q70Z44-4]
ENST00000453435; ENSP00000389268; ENSG00000186090. [Q70Z44-3]
GeneIDi200909.
KEGGihsa:200909.
UCSCiuc010hxp.4. human. [Q70Z44-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ437318 mRNA. Translation: CAD24817.1.
AY159812 mRNA. Translation: AAO38166.2.
AC068644 Genomic DNA. No translation available.
AC131235 Genomic DNA. No translation available.
BC101090 mRNA. Translation: AAI01091.1.
BC101091 mRNA. Translation: AAI01092.1.
CCDSiCCDS3249.1. [Q70Z44-2]
CCDS46966.1. [Q70Z44-4]
CCDS54685.1. [Q70Z44-1]
RefSeqiNP_001138615.1. NM_001145143.1. [Q70Z44-4]
NP_001157118.1. NM_001163646.1. [Q70Z44-1]
NP_872343.2. NM_182537.2.
XP_016861343.1. XM_017005854.1. [Q70Z44-3]
UniGeneiHs.448004.

3D structure databases

ProteinModelPortaliQ70Z44.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128355. 3 interactors.
IntActiQ70Z44. 1 interactor.
STRINGi9606.ENSP00000371929.

Chemistry databases

BindingDBiQ70Z44.
ChEMBLiCHEMBL2094132.
DrugBankiDB01049. Ergoloid mesylate.
DB00898. Ethanol.

Protein family/group databases

TCDBi1.A.9.2.3. the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family.

PTM databases

iPTMnetiQ70Z44.
PhosphoSitePlusiQ70Z44.

Polymorphism and mutation databases

BioMutaiHTR3D.
DMDMi338817899.

Proteomic databases

PaxDbiQ70Z44.
PeptideAtlasiQ70Z44.
PRIDEiQ70Z44.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000382489; ENSP00000371929; ENSG00000186090. [Q70Z44-1]
ENST00000428798; ENSP00000405409; ENSG00000186090. [Q70Z44-4]
ENST00000453435; ENSP00000389268; ENSG00000186090. [Q70Z44-3]
GeneIDi200909.
KEGGihsa:200909.
UCSCiuc010hxp.4. human. [Q70Z44-1]

Organism-specific databases

CTDi200909.
DisGeNETi200909.
GeneCardsiHTR3D.
HGNCiHGNC:24004. HTR3D.
MIMi610122. gene.
neXtProtiNX_Q70Z44.
OpenTargetsiENSG00000186090.
PharmGKBiPA134866755.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3645. Eukaryota.
ENOG410XQGR. LUCA.
GeneTreeiENSGT00790000122957.
HOGENOMiHOG000241519.
HOVERGENiHBG106638.
InParanoidiQ70Z44.
KOiK04819.
OMAiFRAREWV.
OrthoDBiEOG091G0DE5.
PhylomeDBiQ70Z44.
TreeFamiTF315605.

Enzyme and pathway databases

BioCyciZFISH:G66-32385-MONOMER.
ReactomeiR-HSA-975298. Ligand-gated ion channel transport.

Miscellaneous databases

GeneWikiiHTR3D.
GenomeRNAii200909.
PROiQ70Z44.
SOURCEiSearch...

Gene expression databases

CleanExiHS_HTR3D.
ExpressionAtlasiQ70Z44. baseline and differential.

Family and domain databases

Gene3Di1.20.120.370. 1 hit.
2.70.170.10. 1 hit.
InterProiIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
[Graphical view]
PANTHERiPTHR18945. PTHR18945. 1 hit.
PfamiPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view]
SUPFAMiSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry namei5HT3D_HUMAN
AccessioniPrimary (citable) accession number: Q70Z44
Secondary accession number(s): C9J2I6
, J3QT78, Q495N5, Q495N6, Q7Z6B3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: June 28, 2011
Last modified: November 2, 2016
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.