Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q70Z44

- 5HT3D_HUMAN

UniProt

Q70Z44 - 5HT3D_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

5-hydroxytryptamine receptor 3D

Gene

HTR3D

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

GO - Molecular functioni

  1. extracellular ligand-gated ion channel activity Source: InterPro

GO - Biological processi

  1. ion transmembrane transport Source: Reactome
  2. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiREACT_25387. Ligand-gated ion channel transport.

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 3D
Short name:
5-HT3-D
Short name:
5-HT3D
Alternative name(s):
Serotonin receptor 3D
Gene namesi
Name:HTR3D
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:24004. HTR3D.

Subcellular locationi

Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication
Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini25 – 232208ExtracellularSequence AnalysisAdd
BLAST
Transmembranei233 – 25321Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini254 – 26411CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei265 – 28521Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini286 – 30621ExtracellularSequence AnalysisAdd
BLAST
Transmembranei307 – 32721Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini328 – 431104CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei432 – 45221Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini453 – 4542ExtracellularSequence Analysis

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134866755.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424Sequence AnalysisAdd
BLAST
Chaini25 – 4544305-hydroxytryptamine receptor 3DPRO_0000312293Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi66 – 661N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ70Z44.
PRIDEiQ70Z44.

Expressioni

Tissue specificityi

Expressed in liver, as well as fetal and adult colon and kidney.1 Publication

Gene expression databases

CleanExiHS_HTR3D.
GenevestigatoriQ70Z44.

Interactioni

Subunit structurei

Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.1 Publication

Protein-protein interaction databases

STRINGi9606.ENSP00000405409.

Structurei

3D structure databases

ProteinModelPortaliQ70Z44.
SMRiQ70Z44. Positions 50-453.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG302603.
GeneTreeiENSGT00770000120477.
HOGENOMiHOG000241519.
HOVERGENiHBG106638.
InParanoidiQ70Z44.
KOiK04819.
OMAiTEIFLFR.
PhylomeDBiQ70Z44.
TreeFamiTF315605.

Family and domain databases

Gene3Di1.20.120.370. 1 hit.
2.70.170.10. 1 hit.
InterProiIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
[Graphical view]
PANTHERiPTHR18945. PTHR18945. 1 hit.
PfamiPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view]
SUPFAMiSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q70Z44-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQKHSPGPPA LALLSQSLLT TGNGDTLIIN CPGFGQHRVD PAAFQAVFDR
60 70 80 90 100
KAIGPVTNYS VATHVNISFT LSAIWNCYSR IHTFNCHHAR PWHNQFVQWN
110 120 130 140 150
PDECGGIKKS GMATENLWLS DVFIEESVDQ TPAGLMASMS IVKATSNTIS
160 170 180 190 200
QCGWSASANW TPSISPSMDR ARAWRRMSRS FQIHHRTSFR TRREWVLLGI
210 220 230 240 250
QKRTIKVTVA TNQYEQAIFH VAIRRRCRPS PYVVNFLVPS GILIAIDALS
260 270 280 290 300
FYLPLESGNC APFKMTVLLG YSVFLLMMND LLPATSTSSH ASLVAPLALM
310 320 330 340 350
QTPLPAGVYF ALCLSLMVGS LLETIFITHL LHVATTQPLP LPRWLHSLLL
360 370 380 390 400
HCTGQGRCCP TAPQKGNKGP GLTPTHLPGV KEPEVSAGQM PGPGEAELTG
410 420 430 440 450
GSEWTRAQRE HEAQKQHSVE LWVQFSHAMD ALLFRLYLLF MASSIITVIC

LWNT
Length:454
Mass (Da):50,191
Last modified:June 28, 2011 - v3
Checksum:i8B12F6CC31C4446C
GO
Isoform 2 (identifier: Q70Z44-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-135: Missing.
     172-220: RAWRRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFH → ERSPSALSPTQ
     295-306: APLALMQTPLPA → RPHPSRDQKR

Show »
Length:279
Mass (Da):30,477
Checksum:i6B896347F37E902A
GO
Isoform 3 (identifier: Q70Z44-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-219: Missing.
     220-220: H → M
     295-306: APLALMQTPLPA → RPHPSRDQKR

Show »
Length:233
Mass (Da):25,697
Checksum:iCFAF7256BA7195EE
GO
Isoform 4 (identifier: Q70Z44-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQH → MERGWFHGKGFLLGFILHLLLQDSHLQLVTSFLWLNM
     38-98: Missing.
     171-171: A → GERSPSALSPTQVT
     295-306: APLALMQTPLPA → RPHPSRDQKR

Note: No experimental confirmation available.

Show »
Length:404
Mass (Da):45,145
Checksum:i6EE0A9AE03DF8694
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti155 – 1551S → P in AAI01092. (PubMed:15489334)Curated
Sequence conflicti368 – 3681K → R in AAO38166. (PubMed:17392525)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti171 – 1711A → G.1 Publication
Corresponds to variant rs6443930 [ dbSNP | Ensembl ].
VAR_037478
Natural varianti225 – 2251R → H.1 Publication
Corresponds to variant rs1000952 [ dbSNP | Ensembl ].
VAR_037479
Natural varianti435 – 4351R → H.1 Publication
Corresponds to variant rs6789754 [ dbSNP | Ensembl ].
VAR_037480

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 219219Missing in isoform 3. 1 PublicationVSP_029797Add
BLAST
Alternative sequencei1 – 135135Missing in isoform 2. 2 PublicationsVSP_029798Add
BLAST
Alternative sequencei1 – 3737MQKHS…GFGQH → MERGWFHGKGFLLGFILHLL LQDSHLQLVTSFLWLNM in isoform 4. CuratedVSP_044828Add
BLAST
Alternative sequencei38 – 9861Missing in isoform 4. CuratedVSP_044829Add
BLAST
Alternative sequencei171 – 1711A → GERSPSALSPTQVT in isoform 4. CuratedVSP_044830
Alternative sequencei172 – 22049RAWRR…QAIFH → ERSPSALSPTQ in isoform 2. 2 PublicationsVSP_029799Add
BLAST
Alternative sequencei220 – 2201H → M in isoform 3. 1 PublicationVSP_029800
Alternative sequencei295 – 30612APLAL…TPLPA → RPHPSRDQKR in isoform 2, isoform 3 and isoform 4. 2 PublicationsVSP_029801Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ437318 mRNA. Translation: CAD24817.1.
AY159812 mRNA. Translation: AAO38166.2.
AC068644 Genomic DNA. No translation available.
AC131235 Genomic DNA. No translation available.
BC101090 mRNA. Translation: AAI01091.1.
BC101091 mRNA. Translation: AAI01092.1.
CCDSiCCDS3249.1. [Q70Z44-2]
CCDS46966.1. [Q70Z44-4]
CCDS54685.1. [Q70Z44-1]
RefSeqiNP_001138615.1. NM_001145143.1. [Q70Z44-4]
NP_001157118.1. NM_001163646.1. [Q70Z44-1]
NP_872343.2. NM_182537.2.
UniGeneiHs.448004.

Genome annotation databases

EnsembliENST00000382489; ENSP00000371929; ENSG00000186090. [Q70Z44-1]
ENST00000428798; ENSP00000405409; ENSG00000186090. [Q70Z44-4]
ENST00000453435; ENSP00000389268; ENSG00000186090. [Q70Z44-3]
GeneIDi200909.
KEGGihsa:200909.
UCSCiuc010hxp.3. human. [Q70Z44-3]
uc011bqv.2. human. [Q70Z44-1]

Polymorphism databases

DMDMi338817899.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ437318 mRNA. Translation: CAD24817.1 .
AY159812 mRNA. Translation: AAO38166.2 .
AC068644 Genomic DNA. No translation available.
AC131235 Genomic DNA. No translation available.
BC101090 mRNA. Translation: AAI01091.1 .
BC101091 mRNA. Translation: AAI01092.1 .
CCDSi CCDS3249.1. [Q70Z44-2 ]
CCDS46966.1. [Q70Z44-4 ]
CCDS54685.1. [Q70Z44-1 ]
RefSeqi NP_001138615.1. NM_001145143.1. [Q70Z44-4 ]
NP_001157118.1. NM_001163646.1. [Q70Z44-1 ]
NP_872343.2. NM_182537.2.
UniGenei Hs.448004.

3D structure databases

ProteinModelPortali Q70Z44.
SMRi Q70Z44. Positions 50-453.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000405409.

Chemistry

BindingDBi Q70Z44.
ChEMBLi CHEMBL2094132.
DrugBanki DB01049. Ergoloid mesylate.
GuidetoPHARMACOLOGYi 376.

Polymorphism databases

DMDMi 338817899.

Proteomic databases

PaxDbi Q70Z44.
PRIDEi Q70Z44.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000382489 ; ENSP00000371929 ; ENSG00000186090 . [Q70Z44-1 ]
ENST00000428798 ; ENSP00000405409 ; ENSG00000186090 . [Q70Z44-4 ]
ENST00000453435 ; ENSP00000389268 ; ENSG00000186090 . [Q70Z44-3 ]
GeneIDi 200909.
KEGGi hsa:200909.
UCSCi uc010hxp.3. human. [Q70Z44-3 ]
uc011bqv.2. human. [Q70Z44-1 ]

Organism-specific databases

CTDi 200909.
GeneCardsi GC03P183749.
HGNCi HGNC:24004. HTR3D.
MIMi 610122. gene.
neXtProti NX_Q70Z44.
PharmGKBi PA134866755.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG302603.
GeneTreei ENSGT00770000120477.
HOGENOMi HOG000241519.
HOVERGENi HBG106638.
InParanoidi Q70Z44.
KOi K04819.
OMAi TEIFLFR.
PhylomeDBi Q70Z44.
TreeFami TF315605.

Enzyme and pathway databases

Reactomei REACT_25387. Ligand-gated ion channel transport.

Miscellaneous databases

GeneWikii HTR3D.
GenomeRNAii 200909.
NextBioi 35537460.
PROi Q70Z44.
SOURCEi Search...

Gene expression databases

CleanExi HS_HTR3D.
Genevestigatori Q70Z44.

Family and domain databases

Gene3Di 1.20.120.370. 1 hit.
2.70.170.10. 1 hit.
InterProi IPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
[Graphical view ]
PANTHERi PTHR18945. PTHR18945. 1 hit.
Pfami PF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view ]
SUPFAMi SSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, physical mapping and expression analysis of the human 5-HT3 serotonin receptor-like genes HTR3C, HTR3D and HTR3E."
    Niesler B., Frank B., Kapeller J., Rappold G.A.
    Gene 310:101-111(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Characterization of the novel human serotonin receptor subunits 5-HT3C, 5-HT3D, and 5-HT3E."
    Niesler B., Walstab J., Combrink S., Moeller D., Kapeller J., Rietdorf J., Boenisch H., Goethert M., Rappold G., Bruess M.
    Mol. Pharmacol. 72:8-17(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBUNIT, SUBCELLULAR LOCATION, VARIANT GLY-171.
  3. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANTS HIS-225 AND HIS-435.

Entry informationi

Entry namei5HT3D_HUMAN
AccessioniPrimary (citable) accession number: Q70Z44
Secondary accession number(s): C9J2I6
, J3QT78, Q495N5, Q495N6, Q7Z6B3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: June 28, 2011
Last modified: November 26, 2014
This is version 102 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3