Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q70Z44 (5HT3D_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 94. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
5-hydroxytryptamine receptor 3D

Short name=5-HT3-D
Short name=5-HT3D
Alternative name(s):
Serotonin receptor 3D
Gene names
Name:HTR3D
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length454 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

Subunit structure

Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex. Ref.2

Subcellular location

Cell membrane; Multi-pass membrane protein. Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A. Ref.2

Tissue specificity

Expressed in liver, as well as fetal and adult colon and kidney. Ref.1

Sequence similarities

Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3D sub-subfamily. [View classification]

Ontologies

Keywords
   Biological processIon transport
Transport
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal
Transmembrane
Transmembrane helix
   Molecular functionIon channel
Ligand-gated ion channel
Receptor
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_procession transmembrane transport

Traceable author statement. Source: Reactome

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Traceable author statement. Source: Reactome

   Molecular_functionextracellular ligand-gated ion channel activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q70Z44-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q70Z44-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-135: Missing.
     172-220: RAWRRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFH → ERSPSALSPTQ
     295-306: APLALMQTPLPA → RPHPSRDQKR
Isoform 3 (identifier: Q70Z44-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-219: Missing.
     220-220: H → M
     295-306: APLALMQTPLPA → RPHPSRDQKR
Isoform 4 (identifier: Q70Z44-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQH → MERGWFHGKGFLLGFILHLLLQDSHLQLVTSFLWLNM
     38-98: Missing.
     171-171: A → GERSPSALSPTQVT
     295-306: APLALMQTPLPA → RPHPSRDQKR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424 Potential
Chain25 – 4544305-hydroxytryptamine receptor 3D
PRO_0000312293

Regions

Topological domain25 – 232208Extracellular Potential
Transmembrane233 – 25321Helical; Name=1; Potential
Topological domain254 – 26411Cytoplasmic Potential
Transmembrane265 – 28521Helical; Name=2; Potential
Topological domain286 – 30621Extracellular Potential
Transmembrane307 – 32721Helical; Name=3; Potential
Topological domain328 – 431104Cytoplasmic Potential
Transmembrane432 – 45221Helical; Name=4; Potential
Topological domain453 – 4542Extracellular Potential

Amino acid modifications

Glycosylation661N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 219219Missing in isoform 3.
VSP_029797
Alternative sequence1 – 135135Missing in isoform 2.
VSP_029798
Alternative sequence1 – 3737MQKHS…GFGQH → MERGWFHGKGFLLGFILHLL LQDSHLQLVTSFLWLNM in isoform 4.
VSP_044828
Alternative sequence38 – 9861Missing in isoform 4.
VSP_044829
Alternative sequence1711A → GERSPSALSPTQVT in isoform 4.
VSP_044830
Alternative sequence172 – 22049RAWRR…QAIFH → ERSPSALSPTQ in isoform 2.
VSP_029799
Alternative sequence2201H → M in isoform 3.
VSP_029800
Alternative sequence295 – 30612APLAL…TPLPA → RPHPSRDQKR in isoform 2, isoform 3 and isoform 4.
VSP_029801
Natural variant1711A → G. Ref.2
Corresponds to variant rs6443930 [ dbSNP | Ensembl ].
VAR_037478
Natural variant2251R → H. Ref.4
Corresponds to variant rs1000952 [ dbSNP | Ensembl ].
VAR_037479
Natural variant4351R → H. Ref.4
Corresponds to variant rs6789754 [ dbSNP | Ensembl ].
VAR_037480

Experimental info

Sequence conflict1551S → P in AAI01092. Ref.4
Sequence conflict3681K → R in AAO38166. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 28, 2011. Version 3.
Checksum: 8B12F6CC31C4446C

FASTA45450,191
        10         20         30         40         50         60 
MQKHSPGPPA LALLSQSLLT TGNGDTLIIN CPGFGQHRVD PAAFQAVFDR KAIGPVTNYS 

        70         80         90        100        110        120 
VATHVNISFT LSAIWNCYSR IHTFNCHHAR PWHNQFVQWN PDECGGIKKS GMATENLWLS 

       130        140        150        160        170        180 
DVFIEESVDQ TPAGLMASMS IVKATSNTIS QCGWSASANW TPSISPSMDR ARAWRRMSRS 

       190        200        210        220        230        240 
FQIHHRTSFR TRREWVLLGI QKRTIKVTVA TNQYEQAIFH VAIRRRCRPS PYVVNFLVPS 

       250        260        270        280        290        300 
GILIAIDALS FYLPLESGNC APFKMTVLLG YSVFLLMMND LLPATSTSSH ASLVAPLALM 

       310        320        330        340        350        360 
QTPLPAGVYF ALCLSLMVGS LLETIFITHL LHVATTQPLP LPRWLHSLLL HCTGQGRCCP 

       370        380        390        400        410        420 
TAPQKGNKGP GLTPTHLPGV KEPEVSAGQM PGPGEAELTG GSEWTRAQRE HEAQKQHSVE 

       430        440        450 
LWVQFSHAMD ALLFRLYLLF MASSIITVIC LWNT 

« Hide

Isoform 2 [UniParc].

Checksum: 6B896347F37E902A
Show »

FASTA27930,477
Isoform 3 [UniParc].

Checksum: CFAF7256BA7195EE
Show »

FASTA23325,697
Isoform 4 [UniParc].

Checksum: 6EE0A9AE03DF8694
Show »

FASTA40445,145

References

« Hide 'large scale' references
[1]"Cloning, physical mapping and expression analysis of the human 5-HT3 serotonin receptor-like genes HTR3C, HTR3D and HTR3E."
Niesler B., Frank B., Kapeller J., Rappold G.A.
Gene 310:101-111(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[2]"Characterization of the novel human serotonin receptor subunits 5-HT3C, 5-HT3D, and 5-HT3E."
Niesler B., Walstab J., Combrink S., Moeller D., Kapeller J., Rietdorf J., Boenisch H., Goethert M., Rappold G., Bruess M.
Mol. Pharmacol. 72:8-17(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBUNIT, SUBCELLULAR LOCATION, VARIANT GLY-171.
[3]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANTS HIS-225 AND HIS-435.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ437318 mRNA. Translation: CAD24817.1.
AY159812 mRNA. Translation: AAO38166.2.
AC068644 Genomic DNA. No translation available.
AC131235 Genomic DNA. No translation available.
BC101090 mRNA. Translation: AAI01091.1.
BC101091 mRNA. Translation: AAI01092.1.
RefSeqNP_001138615.1. NM_001145143.1.
NP_001157118.1. NM_001163646.1.
NP_872343.2. NM_182537.2.
UniGeneHs.448004.

3D structure databases

ProteinModelPortalQ70Z44.
SMRQ70Z44. Positions 51-322.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000405409.

Chemistry

BindingDBQ70Z44.
ChEMBLCHEMBL2094132.

Polymorphism databases

DMDM300669602.

Proteomic databases

PaxDbQ70Z44.
PRIDEQ70Z44.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000382489; ENSP00000371929; ENSG00000186090. [Q70Z44-1]
ENST00000428798; ENSP00000405409; ENSG00000186090. [Q70Z44-4]
ENST00000453435; ENSP00000389268; ENSG00000186090. [Q70Z44-3]
GeneID200909.
KEGGhsa:200909.
UCSCuc010hxp.3. human. [Q70Z44-3]
uc011bqv.2. human. [Q70Z44-1]

Organism-specific databases

CTD200909.
GeneCardsGC03P183749.
HGNCHGNC:24004. HTR3D.
MIM610122. gene.
neXtProtNX_Q70Z44.
PharmGKBPA134866755.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG302603.
HOGENOMHOG000241519.
HOVERGENHBG106638.
InParanoidQ70Z44.
KOK04819.
TreeFamTF315605.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressQ70Z44.
CleanExHS_HTR3D.
GenevestigatorQ70Z44.

Family and domain databases

Gene3D1.20.120.370. 1 hit.
2.70.170.10. 1 hit.
InterProIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
[Graphical view]
PANTHERPTHR18945. PTHR18945. 1 hit.
PfamPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view]
SUPFAMSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
ProtoNetSearch...

Other

GeneWikiHTR3D.
GenomeRNAi200909.
NextBio35537460.
PROQ70Z44.
SOURCESearch...

Entry information

Entry name5HT3D_HUMAN
AccessionPrimary (citable) accession number: Q70Z44
Secondary accession number(s): C9J2I6 expand/collapse secondary AC list , J3QT78, Q495N5, Q495N6, Q7Z6B3
Entry history
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: June 28, 2011
Last modified: March 19, 2014
This is version 94 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM