Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5-hydroxytryptamine receptor 3D

Gene

HTR3D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

GO - Molecular functioni

Keywordsi

Molecular functionIon channel, Ligand-gated ion channel, Receptor
Biological processIon transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-112314 Neurotransmitter receptors and postsynaptic signal transmission

Protein family/group databases

TCDBi1.A.9.2.3 the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 3D
Short name:
5-HT3-D
Short name:
5-HT3D
Alternative name(s):
Serotonin receptor 3D
Gene namesi
Name:HTR3D
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi

Organism-specific databases

EuPathDBiHostDB:ENSG00000186090.10
HGNCiHGNC:24004 HTR3D
MIMi610122 gene
neXtProtiNX_Q70Z44

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini25 – 232ExtracellularSequence analysisAdd BLAST208
Transmembranei233 – 253Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini254 – 264CytoplasmicSequence analysisAdd BLAST11
Transmembranei265 – 285Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini286 – 306ExtracellularSequence analysisAdd BLAST21
Transmembranei307 – 327Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini328 – 431CytoplasmicSequence analysisAdd BLAST104
Transmembranei432 – 452Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini453 – 454ExtracellularSequence analysis2

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi200909
OpenTargetsiENSG00000186090
PharmGKBiPA134866755

Chemistry databases

ChEMBLiCHEMBL2094132
DrugBankiDB01049 Ergoloid mesylate
DB00898 Ethanol
DB13025 Tiapride

Polymorphism and mutation databases

BioMutaiHTR3D
DMDMi338817899

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Sequence analysisAdd BLAST24
ChainiPRO_000031229325 – 4545-hydroxytryptamine receptor 3DAdd BLAST430

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi66N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ70Z44
PeptideAtlasiQ70Z44
PRIDEiQ70Z44

PTM databases

iPTMnetiQ70Z44
PhosphoSitePlusiQ70Z44

Expressioni

Tissue specificityi

Expressed in liver, as well as fetal and adult colon and kidney.1 Publication

Gene expression databases

BgeeiENSG00000186090
CleanExiHS_HTR3D
ExpressionAtlasiQ70Z44 baseline and differential

Interactioni

Subunit structurei

Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
HTR3AP460985EBI-9008717,EBI-9008743

Protein-protein interaction databases

BioGridi128355, 4 interactors
IntActiQ70Z44, 1 interactor
STRINGi9606.ENSP00000371929

Chemistry databases

BindingDBiQ70Z44

Structurei

3D structure databases

ProteinModelPortaliQ70Z44
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3645 Eukaryota
ENOG410XQGR LUCA
GeneTreeiENSGT00910000144023
HOGENOMiHOG000241519
HOVERGENiHBG106638
InParanoidiQ70Z44
KOiK04819
OMAiIWYNPFI
OrthoDBiEOG091G0DE5
PhylomeDBiQ70Z44
TreeFamiTF315605

Family and domain databases

Gene3Di2.70.170.10, 1 hit
InterProiView protein in InterPro
IPR006202 Neur_chan_lig-bd
IPR036734 Neur_chan_lig-bd_sf
IPR006201 Neur_channel
IPR036719 Neuro-gated_channel_TM_sf
IPR006029 Neurotrans-gated_channel_TM
PANTHERiPTHR18945 PTHR18945, 1 hit
PfamiView protein in Pfam
PF02931 Neur_chan_LBD, 1 hit
PF02932 Neur_chan_memb, 1 hit
SUPFAMiSSF63712 SSF63712, 1 hit
SSF90112 SSF90112, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q70Z44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQKHSPGPPA LALLSQSLLT TGNGDTLIIN CPGFGQHRVD PAAFQAVFDR
60 70 80 90 100
KAIGPVTNYS VATHVNISFT LSAIWNCYSR IHTFNCHHAR PWHNQFVQWN
110 120 130 140 150
PDECGGIKKS GMATENLWLS DVFIEESVDQ TPAGLMASMS IVKATSNTIS
160 170 180 190 200
QCGWSASANW TPSISPSMDR ARAWRRMSRS FQIHHRTSFR TRREWVLLGI
210 220 230 240 250
QKRTIKVTVA TNQYEQAIFH VAIRRRCRPS PYVVNFLVPS GILIAIDALS
260 270 280 290 300
FYLPLESGNC APFKMTVLLG YSVFLLMMND LLPATSTSSH ASLVAPLALM
310 320 330 340 350
QTPLPAGVYF ALCLSLMVGS LLETIFITHL LHVATTQPLP LPRWLHSLLL
360 370 380 390 400
HCTGQGRCCP TAPQKGNKGP GLTPTHLPGV KEPEVSAGQM PGPGEAELTG
410 420 430 440 450
GSEWTRAQRE HEAQKQHSVE LWVQFSHAMD ALLFRLYLLF MASSIITVIC

LWNT
Length:454
Mass (Da):50,191
Last modified:June 28, 2011 - v3
Checksum:i8B12F6CC31C4446C
GO
Isoform 2 (identifier: Q70Z44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-135: Missing.
     172-220: RAWRRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFH → ERSPSALSPTQ
     295-306: APLALMQTPLPA → RPHPSRDQKR

Show »
Length:279
Mass (Da):30,477
Checksum:i6B896347F37E902A
GO
Isoform 3 (identifier: Q70Z44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-219: Missing.
     220-220: H → M
     295-306: APLALMQTPLPA → RPHPSRDQKR

Show »
Length:233
Mass (Da):25,697
Checksum:iCFAF7256BA7195EE
GO
Isoform 4 (identifier: Q70Z44-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQH → MERGWFHGKGFLLGFILHLLLQDSHLQLVTSFLWLNM
     38-98: Missing.
     171-171: A → GERSPSALSPTQVT
     295-306: APLALMQTPLPA → RPHPSRDQKR

Note: No experimental confirmation available.
Show »
Length:404
Mass (Da):45,145
Checksum:i6EE0A9AE03DF8694
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti155S → P in AAI01092 (PubMed:15489334).Curated1
Sequence conflicti368K → R in AAO38166 (PubMed:17392525).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037478171A → G1 PublicationCorresponds to variant dbSNP:rs6443930Ensembl.1
Natural variantiVAR_037479225R → H1 PublicationCorresponds to variant dbSNP:rs1000952Ensembl.1
Natural variantiVAR_037480435R → H1 PublicationCorresponds to variant dbSNP:rs6789754Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0297971 – 219Missing in isoform 3. 1 PublicationAdd BLAST219
Alternative sequenceiVSP_0297981 – 135Missing in isoform 2. 2 PublicationsAdd BLAST135
Alternative sequenceiVSP_0448281 – 37MQKHS…GFGQH → MERGWFHGKGFLLGFILHLL LQDSHLQLVTSFLWLNM in isoform 4. CuratedAdd BLAST37
Alternative sequenceiVSP_04482938 – 98Missing in isoform 4. CuratedAdd BLAST61
Alternative sequenceiVSP_044830171A → GERSPSALSPTQVT in isoform 4. Curated1
Alternative sequenceiVSP_029799172 – 220RAWRR…QAIFH → ERSPSALSPTQ in isoform 2. 2 PublicationsAdd BLAST49
Alternative sequenceiVSP_029800220H → M in isoform 3. 1 Publication1
Alternative sequenceiVSP_029801295 – 306APLAL…TPLPA → RPHPSRDQKR in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ437318 mRNA Translation: CAD24817.1
AY159812 mRNA Translation: AAO38166.2
AC068644 Genomic DNA No translation available.
AC131235 Genomic DNA No translation available.
BC101090 mRNA Translation: AAI01091.1
BC101091 mRNA Translation: AAI01092.1
CCDSiCCDS3249.1 [Q70Z44-2]
CCDS46966.1 [Q70Z44-4]
CCDS54685.1 [Q70Z44-1]
RefSeqiNP_001138615.1, NM_001145143.1 [Q70Z44-4]
NP_001157118.1, NM_001163646.1 [Q70Z44-1]
NP_872343.2, NM_182537.2
XP_016861343.1, XM_017005854.1 [Q70Z44-3]
UniGeneiHs.448004

Genome annotation databases

EnsembliENST00000382489; ENSP00000371929; ENSG00000186090 [Q70Z44-1]
ENST00000428798; ENSP00000405409; ENSG00000186090 [Q70Z44-4]
ENST00000453435; ENSP00000389268; ENSG00000186090 [Q70Z44-3]
GeneIDi200909
KEGGihsa:200909
UCSCiuc010hxp.4 human [Q70Z44-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Entry informationi

Entry namei5HT3D_HUMAN
AccessioniPrimary (citable) accession number: Q70Z44
Secondary accession number(s): C9J2I6
, J3QT78, Q495N5, Q495N6, Q7Z6B3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: June 28, 2011
Last modified: May 23, 2018
This is version 133 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health