Reviewed,
UniProtKB/Swiss-Prot Q70Z35 (PREX2_HUMAN)
Last modified
November 24, 2009.
Version 52.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein Short name=PtdIns(3,4,5)-dependent Rac exchanger 2 Short name=P-Rex2 Alternative name(s): DEP domain-containing protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1606 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDP for free GTP. Its activity is synergistically activated by phosphatidylinositol-3,4,5-triphosphate and the beta gamma subunits of heterotrimeric G protein. Mediates the activation of RAC1 in a PI3K-dependent manner. May be an important mediator of Rac signaling, acting directly downstream of both G protein-coupled receptors and phosphoinositide 3-kinase. Ref.1 Ref.5 Ref.6 |
| Subunit structure | Interacts with RAC1. |
| Tissue specificity | Isoform 1 is highly expressed in skeletal muscle, heart and placenta, absent from peripheral blood leukocytes. Isoform 2 is expressed in skeletal muscle, kidney, small intestine, and placenta. Isoform 3 is expressed in the heart. Ref.1 |
| Domain | PH domain confers substrate specificity and recognition. Able to discriminate between RAC1, RHOA, and CDC42. DH domain alone was unable to confer substrate specificity and recognition. |
| Sequence similarities | Contains 2 DEP domains. Contains 1 DH (DBL-homology) domain. Contains 2 PDZ (DHR) domains. Contains 1 PH domain. |
| Sequence caution | The sequence AK024079 differs from that shown. Reason: Frameshift at position 1134. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Molecular function | Guanine-nucleotide releasing factor |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | G-protein coupled receptor protein signaling pathway Ref.1 Inferred from direct assay. Source: MGI intracellular signaling cascadeInferred from electronic annotation. Source: InterPro regulation of Rho protein signal transductionInferred from electronic annotation. Source: InterPro |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | Rac GTPase activator activity Ref.1 Inferred from direct assay. Source: MGI Rac guanyl-nucleotide exchange factor activity Ref.1Inferred from direct assay. Source: MGI protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| FRAP1 | P42345 | 1 | EBI-1790618,EBI-359260 | |
| FRAP1 | P42345 | 1 | EBI-1790622,EBI-359260 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q70Z35-1) Also known as: P-Rex2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q70Z35-2) Also known as: P-Rexw2A; The sequence of this isoform differs from the canonical sequence as follows: 905-905: K → KVLSLQILEALAKSDEHFVQNCTSLNSLNEVIPTDLQSKFSALCSERIEHLCQRISSYKKVSVLLQ 961-978: Missing. 1016-1060: Missing. 1108-1108: Y → YF 1141-1141: G → GG 1170-1198: DSITNLLKGQAVVRAFDQTKYLTPGRGLQ → QS 1242-1255: EVKCRLLLALLEYS → T 1315-1363: GVLFHFQSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVAN → NIILD 1410-1410: Q → QHVEKLSYKVACKICLLVYT 1450-1471: AFYLDKSNSPPNSTSKAAYVDK → YVTIQLKNQ 1535-1535: R → RR 1570-1577: GARVQNTA → VGLMQTWE 1578-1606: Missing. | ||||||
| Isoform 3 (identifier: Q70Z35-3) The sequence of this isoform differs from the canonical sequence as follows: 906-979: FSRVLKNRAW...HDKENKSSEQ → VQASERFYNF...EMLLAERAPV 980-1606: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1606 | 1606 | Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein | PRO_0000286795 | |||||
Regions | |||||||||
| Domain | 23 – 214 | 192 | DH | ||||||
| Domain | 245 – 361 | 117 | PH | ||||||
| Domain | 390 – 464 | 75 | DEP 1 | ||||||
| Domain | 491 – 566 | 76 | DEP 2 | ||||||
| Domain | 592 – 671 | 80 | PDZ 1 | ||||||
| Domain | 677 – 754 | 78 | PDZ 2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 905 | 1 | K → KVLSLQILEALAKSDEHFVQ NCTSLNSLNEVIPTDLQSKF SALCSERIEHLCQRISSYKK VSVLLQ in isoform 2. | VSP_025149 | |||||
| Alternative sequence | 906 – 979 | 74 | FSRVL…KSSEQ → VQASERFYNFTARHAVWEHS FDLHSVSSTFPVPVTMEFLL LPPPLLGISQDGRQHCIPED LPSQEMLLAERAPV in isoform 3. | VSP_025150 | |||||
| Alternative sequence | 961 – 978 | 18 | Missing in isoform 2. | VSP_025151 | |||||
| Alternative sequence | 980 – 1606 | 627 | Missing in isoform 3. | VSP_025152 | |||||
| Alternative sequence | 1016 – 1060 | 45 | Missing in isoform 2. | VSP_025153 | |||||
| Alternative sequence | 1108 | 1 | Y → YF in isoform 2. | VSP_025154 | |||||
| Alternative sequence | 1141 | 1 | G → GG in isoform 2. | VSP_025155 | |||||
| Alternative sequence | 1170 – 1198 | 29 | DSITN…GRGLQ → QS in isoform 2. | VSP_025156 | |||||
| Alternative sequence | 1242 – 1255 | 14 | EVKCR…LLEYS → T in isoform 2. | VSP_025157 | |||||
| Alternative sequence | 1315 – 1363 | 49 | GVLFH…PLVAN → NIILD in isoform 2. | VSP_025158 | |||||
| Alternative sequence | 1410 | 1 | Q → QHVEKLSYKVACKICLLVYT in isoform 2. | VSP_025159 | |||||
| Alternative sequence | 1450 – 1471 | 22 | AFYLD…AYVDK → YVTIQLKNQ in isoform 2. | VSP_025160 | |||||
| Alternative sequence | 1535 | 1 | R → RR in isoform 2. | VSP_025161 | |||||
| Alternative sequence | 1570 – 1577 | 8 | GARVQNTA → VGLMQTWE in isoform 2. | VSP_025162 | |||||
| Alternative sequence | 1578 – 1606 | 29 | Missing in isoform 2. | VSP_025163 | |||||
| Natural variant | 312 | 1 | D → N: dbSNP rs11784582. | VAR_032163 | |||||
| Natural variant | 537 | 1 | V → I in a colorectal cancer sample; somatic mutation. Ref.7 | VAR_035973 | |||||
| Natural variant | 1571 | 1 | A → E in a colorectal cancer sample; somatic mutation. Ref.7 | VAR_035974 | |||||
Experimental info | |||||||||
| Sequence conflict | 158 | 1 | T → I in AAS82571. Ref.2 | ||||||
| Sequence conflict | 158 | 1 | T → I in AAS82572. Ref.2 | ||||||
| Sequence conflict | 1076 | 1 | E → V in AAS82571. Ref.2 | ||||||
| Sequence conflict | 1076 | 1 | E → V in AK024079. Ref.3 | ||||||
| Sequence conflict | 1268 | 1 | C → R in AAS82571. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "P-Rex2, a new guanine-nucleotide exchange factor for Rac." Donald S., Hill K., Lecureuil C., Barnouin R., Krugmann S., John Coadwell W., Andrews S.R., Walker S.A., Hawkins P.T., Stephens L.R., Welch H.C.E. FEBS Lett. 572:172-176(2004) [PubMed: 15304343] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. Tissue: Brain and Skeletal muscle. |
| [2] | "Cloning and characterization of P-Rex2: an inositol polyphosphate 4-phosphatase domain containing guanine nucleotide exchange factor." Joseph R.E., Norris F.A. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3). Tissue: Mammary gland. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 216-1588 (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 549-1588 (ISOFORM 1). Tissue: Embryo and Teratocarcinoma. |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "P-REX2, a novel PI-3-kinase sensitive Rac exchange factor." Rosenfeldt H., Vazquez-Prado J., Gutkind J.S. FEBS Lett. 572:167-171(2004) [PubMed: 15304342] [Abstract] Cited for: IDENTIFICATION (ISOFORMS 2 AND 3), FUNCTION, ALTERNATIVE SPLICING. |
| [6] | "Substrate specificity and recognition is conferred by the pleckstrin homology domain of the Dbl family guanine nucleotide exchange factor P-Rex2." Joseph R.E., Norris F.A. J. Biol. Chem. 280:27508-27512(2005) [PubMed: 15897194] [Abstract] Cited for: FUNCTION. |
| [7] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ILE-537 AND GLU-1571. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AJ437636 mRNA. Translation: CAD26885.2. AY508996 mRNA. Translation: AAS82571.1. AY508997 mRNA. Translation: AAS82572.1. AK023049 mRNA. Translation: BAB14375.1. Different initiation. AK024079 mRNA. No translation available. AC011853 Genomic DNA. No translation available. AC103783 Genomic DNA. No translation available. AC104416 Genomic DNA. No translation available. BK005160 mRNA. Translation: DAA05333.1. BK005161 mRNA. Translation: DAA05334.1. | |
| IPI | IPI00418875. IPI00418876. IPI00845229. |
| RefSeq | NP_079146.2. NP_079446.3. |
| UniGene | Hs.591867 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1XDV based on UniProtKB Q07889. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q70Z35. 2 interactions. |
| STRING | Q70Z35. |
PTM databases | |
| PhosphoSite | Q70Z35. |
Proteomic databases | |
| PRIDE | Q70Z35. |
Genome annotation databases | |
| Ensembl | ENST00000288368; ENSP00000288368; ENSG00000046889; Homo sapiens. [Genome view] |
| GeneID | 80243. |
| KEGG | hsa:80243. |
| UCSC | uc003xxu.1. human. uc003xxv.1. human. |
Organism-specific databases | |
| CTD | 80243. |
| GeneCards | GC08P069027. |
| H-InvDB | HIX0007567. |
| HGNC | HGNC:22950. PREX2. |
| HPA | HPA015234. |
| MIM | 612139. gene. |
| PharmGKB | PA134967714. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q70Z35. |
| OMA | ARVQNTA |
| OrthoDB | EOG976NKR |
Gene expression databases | |
| ArrayExpress | Q70Z35. |
| Bgee | Q70Z35. |
| CleanEx | HS_PREX2. |
| Genevestigator | Q70Z35. |
Family and domain databases | |
| InterPro | IPR000219. DH-domain. IPR001331. GDS_CDC24_CS. IPR001478. PDZ/DHR/GLGF. IPR011993. PH_type. IPR000591. Pleckstrin/G-protein_interact. IPR001849. Pleckstrin_homology. IPR011991. Wing_hlx_DNA_bd. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. G3DSA:1.20.900.10. RhoGEF. 1 hit. G3DSA:1.10.10.10. Wing_hlx_DNA_bd. 2 hits. |
| Pfam | PF00610. DEP. 2 hits. PF00169. PH. 1 hit. PF00621. RhoGEF. 1 hit. [Graphical view] |
| SMART | SM00049. DEP. 2 hits. SM00228. PDZ. 2 hits. SM00233. PH. 1 hit. SM00325. RhoGEF. 1 hit. [Graphical view] |
| PROSITE | PS50186. DEP. 2 hits. PS00741. DH_1. 1 hit. PS50010. DH_2. 1 hit. PS50106. PDZ. 2 hits. PS50003. PH_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 70689. |
| SOURCE | Search... |
Entry information
| Entry name | PREX2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q70Z35 Secondary accession number(s): Q32KL0 Q9H961 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


