SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q70J99

- UN13D_HUMAN

UniProt

Q70J99 - UN13D_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein unc-13 homolog D

Gene
UNC13D
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse. Regulates assembly of recycling and late endosomal structures, leading to the formation of an endosomal exocytic compartment that fuses with perforin-containing granules at the immunologic synapse and licences them for exocytosis. Regulates Ca2+-dependent secretory lysosome exocytosis in mast cells.2 Publications

GO - Molecular functioni

  1. protein binding Source: UniProtKB

GO - Biological processi

  1. defense response to virus Source: Ensembl
  2. germinal center formation Source: Ensembl
  3. granuloma formation Source: Ensembl
  4. natural killer cell degranulation Source: Ensembl
  5. phagocytosis Source: Ensembl
  6. positive regulation of exocytosis Source: UniProtKB
  7. regulation of mast cell degranulation Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Exocytosis

Names & Taxonomyi

Protein namesi
Recommended name:
Protein unc-13 homolog D
Alternative name(s):
Munc13-4
Gene namesi
Name:UNC13D
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:23147. UNC13D.

Subcellular locationi

Cytoplasm. Membrane; Peripheral membrane protein. Late endosome. Recycling endosome. Lysosome
Note: Colocalizes with cytotoxic granules at the plasma membrane. Localizes to endosomal exocytic vesicles.3 Publications

GO - Cellular componenti

  1. exocytic vesicle Source: UniProtKB
  2. late endosome Source: UniProtKB-SubCell
  3. lysosome Source: UniProtKB
  4. membrane Source: UniProtKB-SubCell
  5. recycling endosome Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endosome, Lysosome, Membrane

Pathology & Biotechi

Involvement in diseasei

Familial hemophagocytic lymphohistiocytosis 3 (FHL3) [MIM:608898]: A rare disorder characterized by immune dysregulation with hypercytokinemia, defective function of natural killer cell, and massive infiltration of several organs by activated lymphocytes and macrophages. The clinical features of the disease include fever, hepatosplenomegaly, cytopenia, and less frequently neurological abnormalities ranging from irritability and hypotonia to seizures, cranial nerve deficits and ataxia.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi608 – 6114Missing: Abolishes localization to lysosomes and interaction with RAB27A. 1 Publication

Keywords - Diseasei

Familial hemophagocytic lymphohistiocytosis

Organism-specific databases

MIMi608898. phenotype.
Orphaneti540. Familial hemophagocytic lymphohistiocytosis.
PharmGKBiPA134919958.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10901090Protein unc-13 homolog DPRO_0000188581Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei150 – 1501Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ70J99.
PaxDbiQ70J99.
PeptideAtlasiQ70J99.
PRIDEiQ70J99.

PTM databases

PhosphoSiteiQ70J99.

Expressioni

Tissue specificityi

Expressed at high levels in spleen, thymus and leukocytes. Also expressed in lung and placenta, and at very low levels in brain, heart, skeletal muscle and kidney. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells.2 Publications

Gene expression databases

ArrayExpressiQ70J99.
BgeeiQ70J99.
CleanExiHS_UNC13D.
GenevestigatoriQ70J99.

Interactioni

Subunit structurei

Interacts with DOC2A By similarity. Interacts with RAB27A.2 Publications

Protein-protein interaction databases

BioGridi128383. 6 interactions.
STRINGi9606.ENSP00000207549.

Structurei

3D structure databases

ProteinModelPortaliQ70J99.
SMRiQ70J99. Positions 116-282, 588-883, 909-1046.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini98 – 221124C2 1Add
BLAST
Domaini557 – 677121MHD1Add
BLAST
Domaini788 – 895108MHD2Add
BLAST
Domaini912 – 1019108C2 2Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni240 – 543304Interaction with RAB27AAdd
BLAST

Domaini

The MHD1 and MHD2 domains mediate localization on recycling endosomes and lysosome.2 Publications

Sequence similaritiesi

Belongs to the unc-13 family.
Contains 2 C2 domains.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG290002.
HOGENOMiHOG000060231.
HOVERGENiHBG104909.
InParanoidiQ70J99.
OMAiPYCLLGI.
OrthoDBiEOG7XPZ4S.
PhylomeDBiQ70J99.
TreeFamiTF315526.

Family and domain databases

Gene3Di2.60.40.150. 2 hits.
InterProiIPR000008. C2_dom.
IPR014770. Munc13_1.
IPR014772. Munc13_dom-2.
IPR019558. Munc13_subgr_dom-2.
[Graphical view]
PfamiPF00168. C2. 2 hits.
PF10540. Membr_traf_MHD. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 4 hits.
PROSITEiPS50004. C2. 2 hits.
PS51258. MHD1. 1 hit.
PS51259. MHD2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q70J99-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MATLLSHPQQ RPPFLRQAIK IRRRRVRDLQ DPPPQMAPEI QPPSHHFSPE     50
QRALLYEDAL YTVLHRLGHP EPNHVTEASE LLRYLQEAFH VEPEEHQQTL 100
QRVRELEKPI FCLKATVKQA KGILGKDVSG FSDPYCLLGI EQGVGVPGGS 150
PGSRHRQKAV VRHTIPEEET HRTQVITQTL NPVWDETFIL EFEDITNASF 200
HLDMWDLDTV ESVRQKLGEL TDLHGLRRIF KEARKDKGQD DFLGNVVLRL 250
QDLRCREDQW YPLEPRTETY PDRGQCHLQF QLIHKRRATS ASRSQPSYTV 300
HLHLLQQLVS HEVTQHEAGS TSWDGSLSPQ AATVLFLHAT QKDLSDFHQS 350
MAQWLAYSRL YQSLEFPSSC LLHPITSIEY QWIQGRLKAE QQEELAASFS 400
SLLTYGLSLI RRFRSVFPLS VSDSPARLQS LLRVLVQMCK MKAFGELCPN 450
TAPLPQLVTE ALQTGTTEWF HLKQQHHQPM VQGIPEAGKA LLGLVQDVIG 500
DLHQCQRTWD KIFHNTLKIH LFSMAFRELQ WLVAKRVQDH TTVVGDVVSP 550
EMGESLFQLY ISLKELCQLR MSSSERDGVL ALDNFHRWFQ PAIPSWLQKT 600
YNEALARVQR AVQMDELVPL GELTKHSTSA VDLSTCFAQI SHTARQLDWP 650
DPEEAFMITV KFVEDTCRLA LVYCSLIKAR ARELSSGQKD QGQAANMLCV 700
VVNDMEQLRL VIGKLPAQLA WEALEQRVGA VLEQGQLQNT LHAQLQSALA 750
GLGHEIRTGV RTLAEQLEVG IAKHIQKLVG VRESVLPEDA ILPLMKFLEV 800
ELCYMNTNLV QENFSSLLTL LWTHTLTVLV EAAASQRSSS LASNRLKIAL 850
QNLEICFHAE GCGLPPKALH TATFQALQRD LELQAASSRE LIRKYFCSRI 900
QQQAETTSEE LGAVTVKASY RASEQKLRVE LLSASSLLPL DSNGSSDPFV 950
QLTLEPRHEF PELAARETQK HKKDLHPLFD ETFEFLVPAE PCRKAGACLL 1000
LTVLDYDTLG ADDLEGEAFL PLREVPGLSG SEEPGEVPQT RLPLTYPAPN 1050
GDPILQLLEG RKGDREAQVF VRLRRHRAKQ ASQHALRPAP 1090
Length:1,090
Mass (Da):123,282
Last modified:July 5, 2004 - v1
Checksum:iA71AD7A4E32C940C
GO
Isoform 2 (identifier: Q70J99-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     286-286: R → RVGRVLGQWPCPALAAVCWVAGLAAPSVRPCLLTEASLQ
     318-325: AGSTSWDG → VLPSWGWA
     326-1090: Missing.

Note: No experimental confirmation available.

Show »
Length:363
Mass (Da):41,642
Checksum:i0B16EF1B686C51CE
GO
Isoform 3 (identifier: Q70J99-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1081-1090: ASQHALRPAP → GIGPSVSWPWPICLLAFLFQPLGWGPGSLGPGLQAQSLLEKGEGTLPKMRLQLPWGEGGGHY

Note: No experimental confirmation available.

Show »
Length:1,142
Mass (Da):128,819
Checksum:i69183E35C9BB1AAF
GO

Sequence cautioni

The sequence BAB15764.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti59 – 591A → T.
Corresponds to variant rs9904366 [ dbSNP | Ensembl ].
VAR_052469
Natural varianti858 – 8581H → Q.
Corresponds to variant rs17496835 [ dbSNP | Ensembl ].
VAR_029771
Natural varianti867 – 8671K → E.
Corresponds to variant rs1135688 [ dbSNP | Ensembl ].
VAR_029772

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei286 – 2861R → RVGRVLGQWPCPALAAVCWV AGLAAPSVRPCLLTEASLQ in isoform 2. VSP_011385
Alternative sequencei318 – 3258AGSTSWDG → VLPSWGWA in isoform 2. VSP_011386
Alternative sequencei326 – 1090765Missing in isoform 2. VSP_011387Add
BLAST
Alternative sequencei1081 – 109010ASQHALRPAP → GIGPSVSWPWPICLLAFLFQ PLGWGPGSLGPGLQAQSLLE KGEGTLPKMRLQLPWGEGGG HY in isoform 3. VSP_037949

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti137 – 1371L → P in BAG63031. 1 Publication
Sequence conflicti476 – 4761H → R in BAG63031. 1 Publication
Sequence conflicti590 – 5901Q → R in BAG63031. 1 Publication
Sequence conflicti796 – 7961K → E in BAG63031. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ578444 mRNA. Translation: CAE17516.1.
AK024474 mRNA. Translation: BAB15764.1. Different initiation.
AK301529 mRNA. Translation: BAG63031.1.
AC087289 Genomic DNA. No translation available.
BC067084 mRNA. Translation: AAH67084.1.
CCDSiCCDS11730.1. [Q70J99-1]
RefSeqiNP_954712.1. NM_199242.2. [Q70J99-1]
UniGeneiHs.41045.

Genome annotation databases

EnsembliENST00000207549; ENSP00000207549; ENSG00000092929. [Q70J99-1]
ENST00000412096; ENSP00000388093; ENSG00000092929. [Q70J99-3]
GeneIDi201294.
KEGGihsa:201294.
UCSCiuc002jpp.3. human. [Q70J99-1]

Polymorphism databases

DMDMi51316668.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

UNC13Dbase

UNC13D mutation db

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ578444 mRNA. Translation: CAE17516.1 .
AK024474 mRNA. Translation: BAB15764.1 . Different initiation.
AK301529 mRNA. Translation: BAG63031.1 .
AC087289 Genomic DNA. No translation available.
BC067084 mRNA. Translation: AAH67084.1 .
CCDSi CCDS11730.1. [Q70J99-1 ]
RefSeqi NP_954712.1. NM_199242.2. [Q70J99-1 ]
UniGenei Hs.41045.

3D structure databases

ProteinModelPortali Q70J99.
SMRi Q70J99. Positions 116-282, 588-883, 909-1046.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 128383. 6 interactions.
STRINGi 9606.ENSP00000207549.

PTM databases

PhosphoSitei Q70J99.

Polymorphism databases

DMDMi 51316668.

Proteomic databases

MaxQBi Q70J99.
PaxDbi Q70J99.
PeptideAtlasi Q70J99.
PRIDEi Q70J99.

Protocols and materials databases

DNASUi 201294.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000207549 ; ENSP00000207549 ; ENSG00000092929 . [Q70J99-1 ]
ENST00000412096 ; ENSP00000388093 ; ENSG00000092929 . [Q70J99-3 ]
GeneIDi 201294.
KEGGi hsa:201294.
UCSCi uc002jpp.3. human. [Q70J99-1 ]

Organism-specific databases

CTDi 201294.
GeneCardsi GC17M073823.
GeneReviewsi UNC13D.
HGNCi HGNC:23147. UNC13D.
MIMi 608897. gene.
608898. phenotype.
neXtProti NX_Q70J99.
Orphaneti 540. Familial hemophagocytic lymphohistiocytosis.
PharmGKBi PA134919958.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG290002.
HOGENOMi HOG000060231.
HOVERGENi HBG104909.
InParanoidi Q70J99.
OMAi PYCLLGI.
OrthoDBi EOG7XPZ4S.
PhylomeDBi Q70J99.
TreeFami TF315526.

Miscellaneous databases

GeneWikii UNC13D.
GenomeRNAii 201294.
NextBioi 90129.
PROi Q70J99.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q70J99.
Bgeei Q70J99.
CleanExi HS_UNC13D.
Genevestigatori Q70J99.

Family and domain databases

Gene3Di 2.60.40.150. 2 hits.
InterProi IPR000008. C2_dom.
IPR014770. Munc13_1.
IPR014772. Munc13_dom-2.
IPR019558. Munc13_subgr_dom-2.
[Graphical view ]
Pfami PF00168. C2. 2 hits.
PF10540. Membr_traf_MHD. 1 hit.
[Graphical view ]
SMARTi SM00239. C2. 2 hits.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 4 hits.
PROSITEi PS50004. C2. 2 hits.
PS51258. MHD1. 1 hit.
PS51259. MHD2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Munc13-4 is essential for cytolytic granules fusion and is mutated in a form of familial hemophagocytic lymphohistiocytosis (FHL3)."
    Feldmann J., Callebaut I., Raposo G., Certain S., Bacq D., Dumont C., Lambert N., Ouachee-Chardin M., Chedville G., Tamary H., Minard-Colin V., Vilmer E., Blanche S., Le Deist F., Fischer A., de Saint Basile G.
    Cell 115:461-473(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INVOLVEMENT IN FHL3.
    Tissue: Blood.
  2. "Characterization of long cDNA clones from human adult spleen."
    Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
    DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Spleen.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Synovium.
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Pancreas.
  6. Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH RAB27A, TISSUE SPECIFICITY, DOMAIN, MUTAGENESIS OF 608-VAL--ALA-611.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Secretory cytotoxic granule maturation and exocytosis require the effector protein hMunc13-4."
    Menager M.M., Menasche G., Romao M., Knapnougel P., Ho C.-H., Garfa M., Raposo G., Feldmann J., Fischer A., de Saint Basile G.
    Nat. Immunol. 8:257-267(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH RAB27A, DOMAIN.
  10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-150, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiUN13D_HUMAN
AccessioniPrimary (citable) accession number: Q70J99
Secondary accession number(s): B4DWG9, Q9H7K5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 5, 2004
Last modified: July 9, 2014
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi