Q70J99 (UN13D_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein unc-13 homolog D Alternative name(s): Munc13-4 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1090 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse. Regulates assembly of recycling and late endosomal structures, leading to the formation of an endosomal exocytic compartment that fuses with perforin-containing granules at the immunologic synapse and licences them for exocytosis. Regulates Ca2+-dependent secretory lysosome exocytosis in mast cells. Ref.6 Ref.9 |
| Subunit structure | Interacts with DOC2A By similarity. Interacts with RAB27A. Ref.6 Ref.9 |
| Subcellular location | Cytoplasm. Membrane; Peripheral membrane protein. Late endosome. Recycling endosome. Lysosome. Note: Colocalizes with cytotoxic granules at the plasma membrane. Localizes to endosomal exocytic vesicles. Ref.1 Ref.6 Ref.9 |
| Tissue specificity | Expressed at high levels in spleen, thymus and leukocytes. Also expressed in lung and placenta, and at very low levels in brain, heart, skeletal muscle and kidney. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells. Ref.1 Ref.6 |
| Domain | The MHD1 and MHD2 domains mediate localization on recycling endosomes and lysosome. Ref.6 Ref.9 |
| Involvement in disease | Familial hemophagocytic lymphohistiocytosis 3 (FHL3) [MIM:608898]: A rare disorder characterized by immune dysregulation with hypercytokinemia, defective function of natural killer cell, and massive infiltration of several organs by activated lymphocytes and macrophages. The clinical features of the disease include fever, hepatosplenomegaly, cytopenia, and less frequently neurological abnormalities ranging from irritability and hypotonia to seizures, cranial nerve deficits and ataxia. |
| Sequence similarities | Belongs to the unc-13 family. Contains 2 C2 domains. Contains 1 MHD1 (MUNC13 homology domain 1) domain. Contains 1 MHD2 (MUNC13 homology domain 2) domain. |
| Sequence caution | The sequence BAB15764.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q70J99-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q70J99-2) The sequence of this isoform differs from the canonical sequence as follows: 286-286: R → RVGRVLGQWPCPALAAVCWVAGLAAPSVRPCLLTEASLQ 318-325: AGSTSWDG → VLPSWGWA 326-1090: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q70J99-3) The sequence of this isoform differs from the canonical sequence as follows: 1081-1090: ASQHALRPAP → GIGPSVSWPWPICLLAFLFQPLGWGPGSLGPGLQAQSLLEKGEGTLPKMRLQLPWGEGGGHY | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1090 | 1090 | Protein unc-13 homolog D | PRO_0000188581 | |||||
Regions | |||||||||
| Domain | 98 – 221 | 124 | C2 1 | ||||||
| Domain | 557 – 677 | 121 | MHD1 | ||||||
| Domain | 788 – 895 | 108 | MHD2 | ||||||
| Domain | 912 – 1019 | 108 | C2 2 | ||||||
| Region | 240 – 543 | 304 | Interaction with RAB27A | ||||||
Amino acid modifications | |||||||||
| Modified residue | 150 | 1 | Phosphoserine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 286 | 1 | R → RVGRVLGQWPCPALAAVCWV AGLAAPSVRPCLLTEASLQ in isoform 2. | VSP_011385 | |||||
| Alternative sequence | 318 – 325 | 8 | AGSTSWDG → VLPSWGWA in isoform 2. | VSP_011386 | |||||
| Alternative sequence | 326 – 1090 | 765 | Missing in isoform 2. | VSP_011387 | |||||
| Alternative sequence | 1081 – 1090 | 10 | ASQHALRPAP → GIGPSVSWPWPICLLAFLFQ PLGWGPGSLGPGLQAQSLLE KGEGTLPKMRLQLPWGEGGG HY in isoform 3. | VSP_037949 | |||||
| Natural variant | 59 | 1 | A → T. Corresponds to variant rs9904366 [ dbSNP | Ensembl ]. | VAR_052469 | |||||
| Natural variant | 858 | 1 | H → Q. Corresponds to variant rs17496835 [ dbSNP | Ensembl ]. | VAR_029771 | |||||
| Natural variant | 867 | 1 | K → E. Corresponds to variant rs1135688 [ dbSNP | Ensembl ]. | VAR_029772 | |||||
Experimental info | |||||||||
| Mutagenesis | 608 – 611 | 4 | Missing: Abolishes localization to lysosomes and interaction with RAB27A. Ref.6 | ||||||
| Sequence conflict | 137 | 1 | L → P in BAG63031. Ref.3 | ||||||
| Sequence conflict | 476 | 1 | H → R in BAG63031. Ref.3 | ||||||
| Sequence conflict | 590 | 1 | Q → R in BAG63031. Ref.3 | ||||||
| Sequence conflict | 796 | 1 | K → E in BAG63031. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Munc13-4 is essential for cytolytic granules fusion and is mutated in a form of familial hemophagocytic lymphohistiocytosis (FHL3)." Feldmann J., Callebaut I., Raposo G., Certain S., Bacq D., Dumont C., Lambert N., Ouachee-Chardin M., Chedville G., Tamary H., Minard-Colin V., Vilmer E., Blanche S., Le Deist F., Fischer A., de Saint Basile G. Cell 115:461-473(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INVOLVEMENT IN FHL3. Tissue: Blood. |
| [2] | "Characterization of long cDNA clones from human adult spleen." Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O. DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Spleen. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Synovium. |
| [4] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreas. |
| [6] | "Munc13-4 is an effector of rab27a and controls secretion of lysosomes in hematopoietic cells." Neeft M., Wieffer M., de Jong A.S., Negroiu G., Metz C.H., van Loon A., Griffith J., Krijgsveld J., Wulffraat N., Koch H., Heck A.J.R., Brose N., Kleijmeer M., van der Sluijs P. Mol. Biol. Cell 16:731-741(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH RAB27A, TISSUE SPECIFICITY, DOMAIN, MUTAGENESIS OF 608-VAL--ALA-611. |
| [7] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [8] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [9] | "Secretory cytotoxic granule maturation and exocytosis require the effector protein hMunc13-4." Menager M.M., Menasche G., Romao M., Knapnougel P., Ho C.-H., Garfa M., Raposo G., Feldmann J., Fischer A., de Saint Basile G. Nat. Immunol. 8:257-267(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH RAB27A, DOMAIN. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-150, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Web resources
| UNC13Dbase UNC13D mutation db |
| GeneReviews |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ578444 mRNA. Translation: CAE17516.1. AK024474 mRNA. Translation: BAB15764.1. Different initiation. AK301529 mRNA. Translation: BAG63031.1. AC087289 Genomic DNA. No translation available. BC067084 mRNA. Translation: AAH67084.1. |
| IPI | IPI00456635. IPI00456636. IPI00940441. |
| RefSeq | NP_954712.1. NM_199242.2. |
| UniGene | Hs.41045. |
3D structure databases | |
| ProteinModelPortal | Q70J99. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000207549. |
PTM databases | |
| PhosphoSite | Q70J99. |
Polymorphism databases | |
| DMDM | 51316668. |
Proteomic databases | |
| PaxDb | Q70J99. |
| PeptideAtlas | Q70J99. |
| PRIDE | Q70J99. |
Protocols and materials databases | |
| DNASU | 201294. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000207549; ENSP00000207549; ENSG00000092929. ENST00000412096; ENSP00000388093; ENSG00000092929. |
| GeneID | 201294. |
| KEGG | hsa:201294. |
| UCSC | uc002jpp.3. human. |
Organism-specific databases | |
| CTD | 201294. |
| GeneCards | GC17M073823. |
| HGNC | HGNC:23147. UNC13D. |
| MIM | 608897. gene. 608898. phenotype. |
| neXtProt | NX_Q70J99. |
| Orphanet | 540. Familial hemophagocytic lymphohistiocytosis. |
| PharmGKB | PA134919958. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG290002. |
| HOGENOM | HOG000060231. |
| HOVERGEN | HBG104909. |
| InParanoid | Q70J99. |
| OMA | PYCLLGI. |
| PhylomeDB | Q70J99. |
Gene expression databases | |
| Bgee | Q70J99. |
| CleanEx | HS_UNC13D. |
| Genevestigator | Q70J99. |
| GermOnline | ENSG00000092929. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR014770. Munc13_1. IPR014772. Munc13_dom-2. IPR019558. Munc13_subgr_dom-2. [Graphical view] |
| Pfam | PF00168. C2. 2 hits. PF10540. Membr_traf_MHD. 1 hit. [Graphical view] |
| SMART | SM00239. C2. 2 hits. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 2 hits. |
| PROSITE | PS50004. C2. 2 hits. PS51258. MHD1. 1 hit. PS51259. MHD2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 201294. |
| NextBio | 90129. |
| SOURCE | Search... |
Entry information
| Entry name | UN13D_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q70J99 Secondary accession number(s): B4DWG9, Q9H7K5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
