Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q70J99

- UN13D_HUMAN

UniProt

Q70J99 - UN13D_HUMAN

Protein

Protein unc-13 homolog D

Gene

UNC13D

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse. Regulates assembly of recycling and late endosomal structures, leading to the formation of an endosomal exocytic compartment that fuses with perforin-containing granules at the immunologic synapse and licences them for exocytosis. Regulates Ca2+-dependent secretory lysosome exocytosis in mast cells.2 Publications

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. defense response to virus Source: Ensembl
    2. germinal center formation Source: Ensembl
    3. granuloma formation Source: Ensembl
    4. natural killer cell degranulation Source: Ensembl
    5. phagocytosis Source: Ensembl
    6. positive regulation of exocytosis Source: UniProtKB
    7. regulation of mast cell degranulation Source: UniProtKB

    Keywords - Biological processi

    Exocytosis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein unc-13 homolog D
    Alternative name(s):
    Munc13-4
    Gene namesi
    Name:UNC13D
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:23147. UNC13D.

    Subcellular locationi

    Cytoplasm. Membrane; Peripheral membrane protein. Late endosome. Recycling endosome. Lysosome
    Note: Colocalizes with cytotoxic granules at the plasma membrane. Localizes to endosomal exocytic vesicles.

    GO - Cellular componenti

    1. exocytic vesicle Source: UniProtKB
    2. late endosome Source: UniProtKB-SubCell
    3. lysosome Source: UniProtKB
    4. membrane Source: UniProtKB-SubCell
    5. recycling endosome Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Endosome, Lysosome, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Familial hemophagocytic lymphohistiocytosis 3 (FHL3) [MIM:608898]: A rare disorder characterized by immune dysregulation with hypercytokinemia, defective function of natural killer cell, and massive infiltration of several organs by activated lymphocytes and macrophages. The clinical features of the disease include fever, hepatosplenomegaly, cytopenia, and less frequently neurological abnormalities ranging from irritability and hypotonia to seizures, cranial nerve deficits and ataxia.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi608 – 6114Missing: Abolishes localization to lysosomes and interaction with RAB27A. 1 Publication

    Keywords - Diseasei

    Familial hemophagocytic lymphohistiocytosis

    Organism-specific databases

    MIMi608898. phenotype.
    Orphaneti540. Familial hemophagocytic lymphohistiocytosis.
    PharmGKBiPA134919958.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10901090Protein unc-13 homolog DPRO_0000188581Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei150 – 1501Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ70J99.
    PaxDbiQ70J99.
    PeptideAtlasiQ70J99.
    PRIDEiQ70J99.

    PTM databases

    PhosphoSiteiQ70J99.

    Expressioni

    Tissue specificityi

    Expressed at high levels in spleen, thymus and leukocytes. Also expressed in lung and placenta, and at very low levels in brain, heart, skeletal muscle and kidney. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells.2 Publications

    Gene expression databases

    ArrayExpressiQ70J99.
    BgeeiQ70J99.
    CleanExiHS_UNC13D.
    GenevestigatoriQ70J99.

    Interactioni

    Subunit structurei

    Interacts with DOC2A By similarity. Interacts with RAB27A.By similarity2 Publications

    Protein-protein interaction databases

    BioGridi128383. 6 interactions.
    STRINGi9606.ENSP00000207549.

    Structurei

    3D structure databases

    ProteinModelPortaliQ70J99.
    SMRiQ70J99. Positions 116-282, 588-883, 909-1046.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini98 – 221124C2 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini557 – 677121MHD1PROSITE-ProRule annotationAdd
    BLAST
    Domaini788 – 895108MHD2PROSITE-ProRule annotationAdd
    BLAST
    Domaini912 – 1019108C2 2PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni240 – 543304Interaction with RAB27AAdd
    BLAST

    Domaini

    The MHD1 and MHD2 domains mediate localization on recycling endosomes and lysosome.2 Publications

    Sequence similaritiesi

    Belongs to the unc-13 family.Curated
    Contains 2 C2 domains.PROSITE-ProRule annotation
    Contains 1 MHD1 (MUNC13 homology domain 1) domain.PROSITE-ProRule annotation
    Contains 1 MHD2 (MUNC13 homology domain 2) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG290002.
    HOGENOMiHOG000060231.
    HOVERGENiHBG104909.
    InParanoidiQ70J99.
    OMAiPYCLLGI.
    OrthoDBiEOG7XPZ4S.
    PhylomeDBiQ70J99.
    TreeFamiTF315526.

    Family and domain databases

    Gene3Di2.60.40.150. 2 hits.
    InterProiIPR000008. C2_dom.
    IPR014770. Munc13_1.
    IPR014772. Munc13_dom-2.
    IPR019558. Munc13_subgr_dom-2.
    [Graphical view]
    PfamiPF00168. C2. 2 hits.
    PF10540. Membr_traf_MHD. 1 hit.
    [Graphical view]
    SMARTiSM00239. C2. 2 hits.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 4 hits.
    PROSITEiPS50004. C2. 2 hits.
    PS51258. MHD1. 1 hit.
    PS51259. MHD2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q70J99-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MATLLSHPQQ RPPFLRQAIK IRRRRVRDLQ DPPPQMAPEI QPPSHHFSPE     50
    QRALLYEDAL YTVLHRLGHP EPNHVTEASE LLRYLQEAFH VEPEEHQQTL 100
    QRVRELEKPI FCLKATVKQA KGILGKDVSG FSDPYCLLGI EQGVGVPGGS 150
    PGSRHRQKAV VRHTIPEEET HRTQVITQTL NPVWDETFIL EFEDITNASF 200
    HLDMWDLDTV ESVRQKLGEL TDLHGLRRIF KEARKDKGQD DFLGNVVLRL 250
    QDLRCREDQW YPLEPRTETY PDRGQCHLQF QLIHKRRATS ASRSQPSYTV 300
    HLHLLQQLVS HEVTQHEAGS TSWDGSLSPQ AATVLFLHAT QKDLSDFHQS 350
    MAQWLAYSRL YQSLEFPSSC LLHPITSIEY QWIQGRLKAE QQEELAASFS 400
    SLLTYGLSLI RRFRSVFPLS VSDSPARLQS LLRVLVQMCK MKAFGELCPN 450
    TAPLPQLVTE ALQTGTTEWF HLKQQHHQPM VQGIPEAGKA LLGLVQDVIG 500
    DLHQCQRTWD KIFHNTLKIH LFSMAFRELQ WLVAKRVQDH TTVVGDVVSP 550
    EMGESLFQLY ISLKELCQLR MSSSERDGVL ALDNFHRWFQ PAIPSWLQKT 600
    YNEALARVQR AVQMDELVPL GELTKHSTSA VDLSTCFAQI SHTARQLDWP 650
    DPEEAFMITV KFVEDTCRLA LVYCSLIKAR ARELSSGQKD QGQAANMLCV 700
    VVNDMEQLRL VIGKLPAQLA WEALEQRVGA VLEQGQLQNT LHAQLQSALA 750
    GLGHEIRTGV RTLAEQLEVG IAKHIQKLVG VRESVLPEDA ILPLMKFLEV 800
    ELCYMNTNLV QENFSSLLTL LWTHTLTVLV EAAASQRSSS LASNRLKIAL 850
    QNLEICFHAE GCGLPPKALH TATFQALQRD LELQAASSRE LIRKYFCSRI 900
    QQQAETTSEE LGAVTVKASY RASEQKLRVE LLSASSLLPL DSNGSSDPFV 950
    QLTLEPRHEF PELAARETQK HKKDLHPLFD ETFEFLVPAE PCRKAGACLL 1000
    LTVLDYDTLG ADDLEGEAFL PLREVPGLSG SEEPGEVPQT RLPLTYPAPN 1050
    GDPILQLLEG RKGDREAQVF VRLRRHRAKQ ASQHALRPAP 1090
    Length:1,090
    Mass (Da):123,282
    Last modified:July 5, 2004 - v1
    Checksum:iA71AD7A4E32C940C
    GO
    Isoform 2 (identifier: Q70J99-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         286-286: R → RVGRVLGQWPCPALAAVCWVAGLAAPSVRPCLLTEASLQ
         318-325: AGSTSWDG → VLPSWGWA
         326-1090: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:363
    Mass (Da):41,642
    Checksum:i0B16EF1B686C51CE
    GO
    Isoform 3 (identifier: Q70J99-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1081-1090: ASQHALRPAP → GIGPSVSWPWPICLLAFLFQPLGWGPGSLGPGLQAQSLLEKGEGTLPKMRLQLPWGEGGGHY

    Note: No experimental confirmation available.

    Show »
    Length:1,142
    Mass (Da):128,819
    Checksum:i69183E35C9BB1AAF
    GO

    Sequence cautioni

    The sequence BAB15764.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti137 – 1371L → P in BAG63031. (PubMed:14702039)Curated
    Sequence conflicti476 – 4761H → R in BAG63031. (PubMed:14702039)Curated
    Sequence conflicti590 – 5901Q → R in BAG63031. (PubMed:14702039)Curated
    Sequence conflicti796 – 7961K → E in BAG63031. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti59 – 591A → T.
    Corresponds to variant rs9904366 [ dbSNP | Ensembl ].
    VAR_052469
    Natural varianti858 – 8581H → Q.
    Corresponds to variant rs17496835 [ dbSNP | Ensembl ].
    VAR_029771
    Natural varianti867 – 8671K → E.
    Corresponds to variant rs1135688 [ dbSNP | Ensembl ].
    VAR_029772

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei286 – 2861R → RVGRVLGQWPCPALAAVCWV AGLAAPSVRPCLLTEASLQ in isoform 2. 1 PublicationVSP_011385
    Alternative sequencei318 – 3258AGSTSWDG → VLPSWGWA in isoform 2. 1 PublicationVSP_011386
    Alternative sequencei326 – 1090765Missing in isoform 2. 1 PublicationVSP_011387Add
    BLAST
    Alternative sequencei1081 – 109010ASQHALRPAP → GIGPSVSWPWPICLLAFLFQ PLGWGPGSLGPGLQAQSLLE KGEGTLPKMRLQLPWGEGGG HY in isoform 3. 1 PublicationVSP_037949

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ578444 mRNA. Translation: CAE17516.1.
    AK024474 mRNA. Translation: BAB15764.1. Different initiation.
    AK301529 mRNA. Translation: BAG63031.1.
    AC087289 Genomic DNA. No translation available.
    BC067084 mRNA. Translation: AAH67084.1.
    CCDSiCCDS11730.1. [Q70J99-1]
    RefSeqiNP_954712.1. NM_199242.2. [Q70J99-1]
    UniGeneiHs.41045.

    Genome annotation databases

    EnsembliENST00000207549; ENSP00000207549; ENSG00000092929. [Q70J99-1]
    ENST00000412096; ENSP00000388093; ENSG00000092929. [Q70J99-3]
    GeneIDi201294.
    KEGGihsa:201294.
    UCSCiuc002jpp.3. human. [Q70J99-1]

    Polymorphism databases

    DMDMi51316668.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    UNC13Dbase

    UNC13D mutation db

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ578444 mRNA. Translation: CAE17516.1 .
    AK024474 mRNA. Translation: BAB15764.1 . Different initiation.
    AK301529 mRNA. Translation: BAG63031.1 .
    AC087289 Genomic DNA. No translation available.
    BC067084 mRNA. Translation: AAH67084.1 .
    CCDSi CCDS11730.1. [Q70J99-1 ]
    RefSeqi NP_954712.1. NM_199242.2. [Q70J99-1 ]
    UniGenei Hs.41045.

    3D structure databases

    ProteinModelPortali Q70J99.
    SMRi Q70J99. Positions 116-282, 588-883, 909-1046.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 128383. 6 interactions.
    STRINGi 9606.ENSP00000207549.

    PTM databases

    PhosphoSitei Q70J99.

    Polymorphism databases

    DMDMi 51316668.

    Proteomic databases

    MaxQBi Q70J99.
    PaxDbi Q70J99.
    PeptideAtlasi Q70J99.
    PRIDEi Q70J99.

    Protocols and materials databases

    DNASUi 201294.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000207549 ; ENSP00000207549 ; ENSG00000092929 . [Q70J99-1 ]
    ENST00000412096 ; ENSP00000388093 ; ENSG00000092929 . [Q70J99-3 ]
    GeneIDi 201294.
    KEGGi hsa:201294.
    UCSCi uc002jpp.3. human. [Q70J99-1 ]

    Organism-specific databases

    CTDi 201294.
    GeneCardsi GC17M073823.
    GeneReviewsi UNC13D.
    HGNCi HGNC:23147. UNC13D.
    MIMi 608897. gene.
    608898. phenotype.
    neXtProti NX_Q70J99.
    Orphaneti 540. Familial hemophagocytic lymphohistiocytosis.
    PharmGKBi PA134919958.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG290002.
    HOGENOMi HOG000060231.
    HOVERGENi HBG104909.
    InParanoidi Q70J99.
    OMAi PYCLLGI.
    OrthoDBi EOG7XPZ4S.
    PhylomeDBi Q70J99.
    TreeFami TF315526.

    Miscellaneous databases

    GeneWikii UNC13D.
    GenomeRNAii 201294.
    NextBioi 90129.
    PROi Q70J99.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q70J99.
    Bgeei Q70J99.
    CleanExi HS_UNC13D.
    Genevestigatori Q70J99.

    Family and domain databases

    Gene3Di 2.60.40.150. 2 hits.
    InterProi IPR000008. C2_dom.
    IPR014770. Munc13_1.
    IPR014772. Munc13_dom-2.
    IPR019558. Munc13_subgr_dom-2.
    [Graphical view ]
    Pfami PF00168. C2. 2 hits.
    PF10540. Membr_traf_MHD. 1 hit.
    [Graphical view ]
    SMARTi SM00239. C2. 2 hits.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 4 hits.
    PROSITEi PS50004. C2. 2 hits.
    PS51258. MHD1. 1 hit.
    PS51259. MHD2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Munc13-4 is essential for cytolytic granules fusion and is mutated in a form of familial hemophagocytic lymphohistiocytosis (FHL3)."
      Feldmann J., Callebaut I., Raposo G., Certain S., Bacq D., Dumont C., Lambert N., Ouachee-Chardin M., Chedville G., Tamary H., Minard-Colin V., Vilmer E., Blanche S., Le Deist F., Fischer A., de Saint Basile G.
      Cell 115:461-473(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INVOLVEMENT IN FHL3.
      Tissue: Blood.
    2. "Characterization of long cDNA clones from human adult spleen."
      Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
      DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Spleen.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Synovium.
    4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Pancreas.
    6. Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH RAB27A, TISSUE SPECIFICITY, DOMAIN, MUTAGENESIS OF 608-VAL--ALA-611.
    7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
      Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
      Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Secretory cytotoxic granule maturation and exocytosis require the effector protein hMunc13-4."
      Menager M.M., Menasche G., Romao M., Knapnougel P., Ho C.-H., Garfa M., Raposo G., Feldmann J., Fischer A., de Saint Basile G.
      Nat. Immunol. 8:257-267(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH RAB27A, DOMAIN.
    10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-150, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiUN13D_HUMAN
    AccessioniPrimary (citable) accession number: Q70J99
    Secondary accession number(s): B4DWG9, Q9H7K5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 16, 2004
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 101 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3