Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synemin

Gene

Synm

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Type-VI intermediate filament (IF) which plays an important cytoskeletal role within the muscle cell cytoskeleton. It forms heteropolymeric IFs with desmin and/or vimentin, and via its interaction with cytoskeletal proteins alpha-dystrobrevin, dystrophin, talin-1, utrophin and vinculin, is able to link these heteropolymeric IFs to adherens-type junctions, such as to the costameres, neuromuscular junctions, and myotendinous junctions within striated muscle cells (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

  • fast-twitch skeletal muscle fiber contraction Source: MGI
  • intermediate filament cytoskeleton organization Source: InterPro

Names & Taxonomyi

Protein namesi
Recommended name:
Synemin1 Publication
Alternative name(s):
DesmuslinBy similarity
Gene namesi
Name:SynmImported
Synonyms:DmnImported, Kiaa0353Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:2661187 Synm

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton, Intermediate filament

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003644381 – 1561SyneminAdd BLAST1561

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei653PhosphothreonineBy similarity1
Modified residuei655PhosphoserineBy similarity1
Modified residuei778PhosphoserineCombined sources1
Modified residuei780PhosphoserineCombined sources1
Modified residuei1044PhosphoserineBy similarity1
Modified residuei1049PhosphoserineCombined sources1
Modified residuei1077PhosphoserineCombined sources1
Modified residuei1087PhosphoserineCombined sources1
Modified residuei1179PhosphoserineBy similarity1
Modified residuei1182PhosphoserineBy similarity1
Modified residuei1425PhosphoserineBy similarity1
Modified residuei1481Omega-N-methylarginineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

PaxDbiQ70IV5
PeptideAtlasiQ70IV5
PRIDEiQ70IV5

PTM databases

iPTMnetiQ70IV5
PhosphoSitePlusiQ70IV5

Expressioni

Tissue specificityi

Isoform 2 and isoform 3 are detected in adult skeletal muscle, heart and bladder, whereas isoform 1 is only detected in adult bladder (at protein level).1 Publication

Developmental stagei

At E11.5, isoform 1 and isoform 2 are widely expressed in the developing nervous and vascular systems and are also found specifically associated with vimentin in endothelial cells. By E15, isoform 1, isoform 2 and isoform 3, are found coexpressed with neurofilament, peripherin and internexin in the peripheral nervous system (at protein level). In the developing embryo, isoform 2 is detected as early as E5, whereas isoform 1 is first observed at E9 in the nervous system and mesodermic derivatives. Isoform 3 is observed later in neurons at E15.1 Publication

Inductioni

Up-regulated in reactive astrocytes following neurotrauma (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000030554
ExpressionAtlasiQ70IV5 baseline and differential
GenevisibleiQ70IV5 MM

Interactioni

Subunit structurei

Interacts with DES, DMD, DTNA, TLN1, UTRN and VCL (By similarity). Isoform 1 and isoform 2 interact with GFAP and VIM.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
TtnA2ASS63EBI-9989763,EBI-9672947

GO - Molecular functioni

Protein-protein interaction databases

BioGridi231405, 1 interactor
IntActiQ70IV5, 3 interactors
MINTiQ70IV5
STRINGi10090.ENSMUSP00000073855

Structurei

3D structure databases

ProteinModelPortaliQ70IV5
SMRiQ70IV5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini11 – 322IF rodPROSITE-ProRule annotationAdd BLAST312

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 10HeadSequence analysis10
Regioni11 – 320Interaction with DMD and UTRNBy similarityAdd BLAST310
Regioni11 – 49Coil 1ASequence analysisAdd BLAST39
Regioni50 – 58Linker 1Sequence analysis9
Regioni59 – 163Coil 1BSequence analysisAdd BLAST105
Regioni164 – 186Linker 12Sequence analysisAdd BLAST23
Regioni187 – 300Coil 2Sequence analysisAdd BLAST114
Regioni301 – 1561TailSequence analysisAdd BLAST1261
Regioni1152 – 1453Interaction with TLN1 and VCLBy similarityAdd BLAST302
Regioni1242 – 1557Interaction with DMD and UTRNBy similarityAdd BLAST316

Sequence similaritiesi

Belongs to the intermediate filament family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IH92 Eukaryota
ENOG4111GBF LUCA
GeneTreeiENSGT00730000110953
HOGENOMiHOG000154476
HOVERGENiHBG008974
InParanoidiQ70IV5
KOiK10376
OMAiSWRLQTG
OrthoDBiEOG091G00OT
PhylomeDBiQ70IV5

Family and domain databases

InterProiView protein in InterPro
IPR001664 IF
IPR018039 IF_conserved
IPR039008 IF_rod_dom
IPR030634 SYNM
PANTHERiPTHR23239 PTHR23239, 1 hit
PTHR23239:SF194 PTHR23239:SF194, 1 hit
PfamiView protein in Pfam
PF00038 Filament, 1 hit
SMARTiView protein in SMART
SM01391 Filament, 1 hit
PROSITEiView protein in PROSITE
PS00226 IF_ROD_1, 1 hit
PS51842 IF_ROD_2, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q70IV5-1) [UniParc]FASTAAdd to basket
Also known as: H1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSWRLQTGS EKAELQELNA RLYDYVCRVR ELERENLLLE EELRSRLSRE
60 70 80 90 100
DRWAEDQALY AEEARSLRQQ LDELNWSTAL AEGERDALRR ELLELQREGV
110 120 130 140 150
EAGTARSRLD AELGAQRREL EEALGARAAL EALLGRLETE RRDLDAAHER
160 170 180 190 200
QVRDLRARAA SLTMHFRARA TSPAAPPPRL RDVHDSYALL VAESWRESVQ
210 220 230 240 250
LYEDEVRELE QALRRGQESR LQAEDEARLC AQEADALRNQ ALELEQLRAR
260 270 280 290 300
LEDELLRMRE EYGMQAEERQ RVIDSLEDEK EALTLAMADR LRDYQELLQV
310 320 330 340 350
KTGLSLEVAT YRALLEGESN PEILIWTENI ENVPQEPRNT SYRYTNSVLQ
360 370 380 390 400
RKNEKNLFPR RKTPWAAVNH SSASYSNWPG HLDSQTTTAV GSAARRGLLT
410 420 430 440 450
SRHSSSATTS GQQKPLEKTI SSRANLRPVT PTHGFLRNTD AQMKTLPHRS
460 470 480 490 500
KVEGTGDTHA RRATESVITR ESYRGHQGHV AAGAVSSTPS NERTVILGKK
510 520 530 540 550
LEAQATKEQE RDRSGVIRIK PEEKMFDSKE KASEERNLRW EELTKLDRDA
560 570 580 590 600
RKRESRHLRD EAREKEALKE RSVKEREVPI SLEVSRGSRA EVSTIHLQSP
610 620 630 640 650
GRKDVSHSGG REAETKETRF RLDTQDTASS LQSDSTTETI AESIVTTILK
660 670 680 690 700
QFTQSPGAEE EATSFPDTKV TYVDRKEFPG DGKTKTEIVV ESKLTDVVDV
710 720 730 740 750
SDEAGLDYLL SKDVKEVGLK GKSTETMIGE MINLGLKGRE GRAKVVNVEI
760 770 780 790 800
VEEPMSYIGG GKIDFSTPFQ VEEVDDVSPS PKGFVEEEDG EGETHMAFSM
810 820 830 840 850
RPHQTKQPQG TIPHVEEVTE AGDSEGEQSY FVSTPDEYPG GHDREDDGSV
860 870 880 890 900
YGQIHIEEES TIRYSWQDEI AQGTWRRKMR GDVGGEKPVK VLEVPALSLG
910 920 930 940 950
GAIGSAHLKE EASGELRAEP TVIEKEIKIP HEFHTSIKGV FSSEPRHQLV
960 970 980 990 1000
EVIGQLEETL PERMKEELSA LTRQSQGESG SVSVDVKKVQ SAAGGSVTLM
1010 1020 1030 1040 1050
AEVNLSQTVD ADQLDLEQLS RDEAGEIERA VESVVRESLA KRSSPVPRSP
1060 1070 1080 1090 1100
DREDGEEVPA GGILFKRWAT RELYSPSGER DDAGQVSPSS DQRVTQGPVS
1110 1120 1130 1140 1150
ATVEVTSPTG FVQSHVLEDV SQSVRHVKLG PTEMWRTEQV TFGGPTAQVV
1160 1170 1180 1190 1200
EVSGDFSEAV SSEGASRSVR HITLGPHQSQ VSTEVIFRGS VPTWQETGDT
1210 1220 1230 1240 1250
EKPGPVVLSV GADISGSGRM PGSERSHTEK EIRFQGPVSG TAQVGGNFAT
1260 1270 1280 1290 1300
EESVGSQTFV RSLQLGPKEG FREEIQFIAP IPDKVGWGEE DSEHTKVSLE
1310 1320 1330 1340 1350
RATSIQRIDI VPQRYLASKQ MAPQTLEFRD SEDMVMVEGS AGTIQATHNF
1360 1370 1380 1390 1400
TSDREILQNK ENTFQRVISG SPPDSVGDTG AEVTANVSRS FRHIQIGPTE
1410 1420 1430 1440 1450
EEPSEYFVTG RPVSKTFVLD GSVASPGLVG GADGGSTPCR IALGPKETSF
1460 1470 1480 1490 1500
TFQMDLSDTR AIRSWTRDTG SEVEAHGVSH RGGWRIAHSR DERVASTGSG
1510 1520 1530 1540 1550
ASPGDAHQAP GEKGTEQAGF DKTVQLQRMV DQRSVASDEK KVALLYLDNE
1560
EEEEEEGEGW F
Length:1,561
Mass (Da):173,209
Last modified:March 3, 2009 - v2
Checksum:i1DFC4DA574CC6A43
GO
Isoform 21 Publication (identifier: Q70IV5-2) [UniParc]FASTAAdd to basket
Also known as: M1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1152-1453: Missing.

Show »
Length:1,259
Mass (Da):140,869
Checksum:i50FC7B65F0948C69
GO
Isoform 31 Publication (identifier: Q70IV5-3) [UniParc]FASTAAdd to basket
Also known as: L1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     336-371: EPRNTSYRYTNSVLQRKNEKNLFPRRKTPWAAVNHS → DGFERHESDPQLDPRHRVGSGSSRRVSPWWLENCTQ
     372-1561: Missing.

Show »
Length:371
Mass (Da):43,147
Checksum:i4946F4D301A1BC3F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti122E → K in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti122E → K in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti122E → K in CAE30279 (PubMed:15265691).Curated1
Sequence conflicti223A → S in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti223A → S in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti223A → S in CAE30279 (PubMed:15265691).Curated1
Sequence conflicti577E → G in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti577E → G in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti830Y → C in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti830Y → C in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti835P → S in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti835P → S in BAD32215 (PubMed:15368895).Curated1
Sequence conflicti896A → T in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti896A → T in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti993A → V in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti993A → V in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti1064L → F in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1064L → F in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti1072E → D in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1072E → D in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti1077S → F in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1077S → F in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti1114S → F in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1114S → F in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti1123S → F in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1123S → F in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti1129L → I in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1129L → I in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti1167R → P in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1206V → A in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1241T → A in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1348H → Q in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1499S → F in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1499S → F in CAE30278 (PubMed:15265691).Curated1
Sequence conflicti1556Missing in CAE30277 (PubMed:15265691).Curated1
Sequence conflicti1556Missing in CAE30278 (PubMed:15265691).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_053033336 – 371EPRNT…AVNHS → DGFERHESDPQLDPRHRVGS GSSRRVSPWWLENCTQ in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_053034372 – 1561Missing in isoform 3. 1 PublicationAdd BLAST1190
Alternative sequenceiVSP_0530351152 – 1453Missing in isoform 2. 2 PublicationsAdd BLAST302

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ579700 mRNA Translation: CAE30277.1
AJ579701 mRNA Translation: CAE30278.1
AJ579702 mRNA Translation: CAE30279.1
AK143019 mRNA Translation: BAE25250.1
AC158296 Genomic DNA No translation available.
AK172937 mRNA Translation: BAD32215.1
CCDSiCCDS39982.1 [Q70IV5-1]
CCDS39983.1 [Q70IV5-2]
CCDS85316.1 [Q70IV5-3]
RefSeqiNP_899135.3, NM_183312.3
NP_964001.2, NM_201639.2 [Q70IV5-1]
NP_997546.2, NM_207663.3 [Q70IV5-2]
UniGeneiMm.60526

Genome annotation databases

EnsembliENSMUST00000051389; ENSMUSP00000050987; ENSMUSG00000030554 [Q70IV5-2]
ENSMUST00000074233; ENSMUSP00000073855; ENSMUSG00000030554 [Q70IV5-1]
GeneIDi233335
KEGGimmu:233335
UCSCiuc009hiv.1 mouse [Q70IV5-2]
uc009hiw.1 mouse [Q70IV5-1]
uc009hix.1 mouse [Q70IV5-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSYNEM_MOUSE
AccessioniPrimary (citable) accession number: Q70IV5
Secondary accession number(s): Q3UPZ4
, Q6A081, Q70IV3, Q70IV4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 3, 2009
Last sequence update: March 3, 2009
Last modified: May 23, 2018
This is version 109 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health