Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synemin

Gene

Synm

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Type-VI intermediate filament (IF) which plays an important cytoskeletal role within the muscle cell cytoskeleton. It forms heteropolymeric IFs with desmin and/or vimentin, and via its interaction with cytoskeletal proteins alpha-dystrobrevin, dystrophin, talin-1, utrophin and vinculin, is able to link these heteropolymeric IFs to adherens-type junctions, such as to the costameres, neuromuscular junctions, and myotendinous junctions within striated muscle cells (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

  • fast-twitch skeletal muscle fiber contraction Source: MGI
  • intermediate filament cytoskeleton organization Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Synemin1 Publication
Alternative name(s):
DesmuslinBy similarity
Gene namesi
Name:SynmImported
Synonyms:DmnImported, Kiaa0353Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:2661187. Synm.

Subcellular locationi

  • Cytoplasmcytoskeleton 1 Publication
  • Cell junctionadherens junction By similarity

  • Note: There are at least two distinct SYNM subpopulations, one in which SYMN interacts with DES within the Z-lines, and another in which it interacts with both DTNA and DES at the costamere.By similarity1 Publication

GO - Cellular componenti

  • adherens junction Source: UniProtKB
  • costamere Source: UniProtKB
  • intermediate filament Source: UniProtKB
  • membrane Source: MGI
  • neurofilament cytoskeleton Source: MGI
  • sarcolemma Source: MGI
  • Z disc Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton, Intermediate filament

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 15611561SyneminPRO_0000364438Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei778 – 7781PhosphoserineCombined sources
Modified residuei780 – 7801PhosphoserineCombined sources
Modified residuei1044 – 10441PhosphoserineBy similarity
Modified residuei1049 – 10491PhosphoserineCombined sources
Modified residuei1077 – 10771PhosphoserineCombined sources
Modified residuei1087 – 10871PhosphoserineCombined sources
Modified residuei1179 – 11791PhosphoserineBy similarity
Modified residuei1182 – 11821PhosphoserineBy similarity
Modified residuei1425 – 14251PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ70IV5.
PaxDbiQ70IV5.
PRIDEiQ70IV5.

PTM databases

iPTMnetiQ70IV5.
PhosphoSiteiQ70IV5.

Expressioni

Tissue specificityi

Isoform 2 and isoform 3 are detected in adult skeletal muscle, heart and bladder, whereas isoform 1 is only detected in adult bladder (at protein level).1 Publication

Developmental stagei

At E11.5, isoform 1 and isoform 2 are widely expressed in the developing nervous and vascular systems and are also found specifically associated with vimentin in endothelial cells. By E15, isoform 1, isoform 2 and isoform 3, are found coexpressed with neurofilament, peripherin and internexin in the peripheral nervous system (at protein level). In the developing embryo, isoform 2 is detected as early as E5, whereas isoform 1 is first observed at E9 in the nervous system and mesodermic derivatives. Isoform 3 is observed later in neurons at E15.1 Publication

Inductioni

Up-regulated in reactive astrocytes following neurotrauma (at protein level).1 Publication

Gene expression databases

BgeeiQ70IV5.
GenevisibleiQ70IV5. MM.

Interactioni

Subunit structurei

Interacts with DES, DMD, DTNA, TLN1, UTRN and VCL (By similarity). Isoform 1 and isoform 2 interact with GFAP and VIM.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
TtnA2ASS63EBI-9989763,EBI-9672947

GO - Molecular functioni

  • intermediate filament binding Source: UniProtKB
  • protein binding, bridging Source: MGI
  • vinculin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi231405. 1 interaction.
IntActiQ70IV5. 2 interactions.
STRINGi10090.ENSMUSP00000073855.

Structurei

3D structure databases

ProteinModelPortaliQ70IV5.
SMRiQ70IV5. Positions 251-318.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 1010HeadSequence analysis
Regioni11 – 320310Interaction with DMD and UTRNBy similarityAdd
BLAST
Regioni11 – 300290RodSequence analysisAdd
BLAST
Regioni11 – 4939Coil 1ASequence analysisAdd
BLAST
Regioni50 – 589Linker 1Sequence analysis
Regioni59 – 163105Coil 1BSequence analysisAdd
BLAST
Regioni164 – 18623Linker 12Sequence analysisAdd
BLAST
Regioni187 – 300114Coil 2Sequence analysisAdd
BLAST
Regioni301 – 15611261TailSequence analysisAdd
BLAST
Regioni1152 – 1453302Interaction with TLN1 and VCLBy similarityAdd
BLAST
Regioni1242 – 1557316Interaction with DMD and UTRNBy similarityAdd
BLAST

Sequence similaritiesi

Belongs to the intermediate filament family.Sequence analysis

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IH92. Eukaryota.
ENOG4111GBF. LUCA.
GeneTreeiENSGT00730000110953.
HOGENOMiHOG000154476.
HOVERGENiHBG008974.
InParanoidiQ70IV5.
KOiK10376.
OMAiSTPDEYP.
OrthoDBiEOG7W1530.
PhylomeDBiQ70IV5.

Family and domain databases

InterProiIPR001664. IF.
IPR018039. Intermediate_filament_CS.
IPR030634. SYNM.
[Graphical view]
PANTHERiPTHR23239. PTHR23239. 1 hit.
PTHR23239:SF194. PTHR23239:SF194. 1 hit.
PfamiPF00038. Filament. 1 hit.
[Graphical view]
SMARTiSM01391. Filament. 1 hit.
[Graphical view]
PROSITEiPS00226. IF. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q70IV5-1) [UniParc]FASTAAdd to basket

Also known as: H1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSWRLQTGS EKAELQELNA RLYDYVCRVR ELERENLLLE EELRSRLSRE
60 70 80 90 100
DRWAEDQALY AEEARSLRQQ LDELNWSTAL AEGERDALRR ELLELQREGV
110 120 130 140 150
EAGTARSRLD AELGAQRREL EEALGARAAL EALLGRLETE RRDLDAAHER
160 170 180 190 200
QVRDLRARAA SLTMHFRARA TSPAAPPPRL RDVHDSYALL VAESWRESVQ
210 220 230 240 250
LYEDEVRELE QALRRGQESR LQAEDEARLC AQEADALRNQ ALELEQLRAR
260 270 280 290 300
LEDELLRMRE EYGMQAEERQ RVIDSLEDEK EALTLAMADR LRDYQELLQV
310 320 330 340 350
KTGLSLEVAT YRALLEGESN PEILIWTENI ENVPQEPRNT SYRYTNSVLQ
360 370 380 390 400
RKNEKNLFPR RKTPWAAVNH SSASYSNWPG HLDSQTTTAV GSAARRGLLT
410 420 430 440 450
SRHSSSATTS GQQKPLEKTI SSRANLRPVT PTHGFLRNTD AQMKTLPHRS
460 470 480 490 500
KVEGTGDTHA RRATESVITR ESYRGHQGHV AAGAVSSTPS NERTVILGKK
510 520 530 540 550
LEAQATKEQE RDRSGVIRIK PEEKMFDSKE KASEERNLRW EELTKLDRDA
560 570 580 590 600
RKRESRHLRD EAREKEALKE RSVKEREVPI SLEVSRGSRA EVSTIHLQSP
610 620 630 640 650
GRKDVSHSGG REAETKETRF RLDTQDTASS LQSDSTTETI AESIVTTILK
660 670 680 690 700
QFTQSPGAEE EATSFPDTKV TYVDRKEFPG DGKTKTEIVV ESKLTDVVDV
710 720 730 740 750
SDEAGLDYLL SKDVKEVGLK GKSTETMIGE MINLGLKGRE GRAKVVNVEI
760 770 780 790 800
VEEPMSYIGG GKIDFSTPFQ VEEVDDVSPS PKGFVEEEDG EGETHMAFSM
810 820 830 840 850
RPHQTKQPQG TIPHVEEVTE AGDSEGEQSY FVSTPDEYPG GHDREDDGSV
860 870 880 890 900
YGQIHIEEES TIRYSWQDEI AQGTWRRKMR GDVGGEKPVK VLEVPALSLG
910 920 930 940 950
GAIGSAHLKE EASGELRAEP TVIEKEIKIP HEFHTSIKGV FSSEPRHQLV
960 970 980 990 1000
EVIGQLEETL PERMKEELSA LTRQSQGESG SVSVDVKKVQ SAAGGSVTLM
1010 1020 1030 1040 1050
AEVNLSQTVD ADQLDLEQLS RDEAGEIERA VESVVRESLA KRSSPVPRSP
1060 1070 1080 1090 1100
DREDGEEVPA GGILFKRWAT RELYSPSGER DDAGQVSPSS DQRVTQGPVS
1110 1120 1130 1140 1150
ATVEVTSPTG FVQSHVLEDV SQSVRHVKLG PTEMWRTEQV TFGGPTAQVV
1160 1170 1180 1190 1200
EVSGDFSEAV SSEGASRSVR HITLGPHQSQ VSTEVIFRGS VPTWQETGDT
1210 1220 1230 1240 1250
EKPGPVVLSV GADISGSGRM PGSERSHTEK EIRFQGPVSG TAQVGGNFAT
1260 1270 1280 1290 1300
EESVGSQTFV RSLQLGPKEG FREEIQFIAP IPDKVGWGEE DSEHTKVSLE
1310 1320 1330 1340 1350
RATSIQRIDI VPQRYLASKQ MAPQTLEFRD SEDMVMVEGS AGTIQATHNF
1360 1370 1380 1390 1400
TSDREILQNK ENTFQRVISG SPPDSVGDTG AEVTANVSRS FRHIQIGPTE
1410 1420 1430 1440 1450
EEPSEYFVTG RPVSKTFVLD GSVASPGLVG GADGGSTPCR IALGPKETSF
1460 1470 1480 1490 1500
TFQMDLSDTR AIRSWTRDTG SEVEAHGVSH RGGWRIAHSR DERVASTGSG
1510 1520 1530 1540 1550
ASPGDAHQAP GEKGTEQAGF DKTVQLQRMV DQRSVASDEK KVALLYLDNE
1560
EEEEEEGEGW F
Length:1,561
Mass (Da):173,209
Last modified:March 3, 2009 - v2
Checksum:i1DFC4DA574CC6A43
GO
Isoform 21 Publication (identifier: Q70IV5-2) [UniParc]FASTAAdd to basket

Also known as: M1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1152-1453: Missing.

Show »
Length:1,259
Mass (Da):140,869
Checksum:i50FC7B65F0948C69
GO
Isoform 31 Publication (identifier: Q70IV5-3) [UniParc]FASTAAdd to basket

Also known as: L1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     336-371: EPRNTSYRYTNSVLQRKNEKNLFPRRKTPWAAVNHS → DGFERHESDPQLDPRHRVGSGSSRRVSPWWLENCTQ
     372-1561: Missing.

Show »
Length:371
Mass (Da):43,147
Checksum:i4946F4D301A1BC3F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti122 – 1221E → K in CAE30277 (PubMed:15265691).Curated
Sequence conflicti122 – 1221E → K in CAE30278 (PubMed:15265691).Curated
Sequence conflicti122 – 1221E → K in CAE30279 (PubMed:15265691).Curated
Sequence conflicti223 – 2231A → S in CAE30277 (PubMed:15265691).Curated
Sequence conflicti223 – 2231A → S in CAE30278 (PubMed:15265691).Curated
Sequence conflicti223 – 2231A → S in CAE30279 (PubMed:15265691).Curated
Sequence conflicti577 – 5771E → G in CAE30277 (PubMed:15265691).Curated
Sequence conflicti577 – 5771E → G in CAE30278 (PubMed:15265691).Curated
Sequence conflicti830 – 8301Y → C in CAE30277 (PubMed:15265691).Curated
Sequence conflicti830 – 8301Y → C in CAE30278 (PubMed:15265691).Curated
Sequence conflicti835 – 8351P → S in CAE30277 (PubMed:15265691).Curated
Sequence conflicti835 – 8351P → S in BAD32215 (PubMed:15368895).Curated
Sequence conflicti896 – 8961A → T in CAE30277 (PubMed:15265691).Curated
Sequence conflicti896 – 8961A → T in CAE30278 (PubMed:15265691).Curated
Sequence conflicti993 – 9931A → V in CAE30277 (PubMed:15265691).Curated
Sequence conflicti993 – 9931A → V in CAE30278 (PubMed:15265691).Curated
Sequence conflicti1064 – 10641L → F in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1064 – 10641L → F in CAE30278 (PubMed:15265691).Curated
Sequence conflicti1072 – 10721E → D in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1072 – 10721E → D in CAE30278 (PubMed:15265691).Curated
Sequence conflicti1077 – 10771S → F in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1077 – 10771S → F in CAE30278 (PubMed:15265691).Curated
Sequence conflicti1114 – 11141S → F in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1114 – 11141S → F in CAE30278 (PubMed:15265691).Curated
Sequence conflicti1123 – 11231S → F in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1123 – 11231S → F in CAE30278 (PubMed:15265691).Curated
Sequence conflicti1129 – 11291L → I in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1129 – 11291L → I in CAE30278 (PubMed:15265691).Curated
Sequence conflicti1167 – 11671R → P in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1206 – 12061V → A in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1241 – 12411T → A in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1348 – 13481H → Q in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1499 – 14991S → F in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1499 – 14991S → F in CAE30278 (PubMed:15265691).Curated
Sequence conflicti1556 – 15561Missing in CAE30277 (PubMed:15265691).Curated
Sequence conflicti1556 – 15561Missing in CAE30278 (PubMed:15265691).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei336 – 37136EPRNT…AVNHS → DGFERHESDPQLDPRHRVGS GSSRRVSPWWLENCTQ in isoform 3. 1 PublicationVSP_053033Add
BLAST
Alternative sequencei372 – 15611190Missing in isoform 3. 1 PublicationVSP_053034Add
BLAST
Alternative sequencei1152 – 1453302Missing in isoform 2. 2 PublicationsVSP_053035Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ579700 mRNA. Translation: CAE30277.1.
AJ579701 mRNA. Translation: CAE30278.1.
AJ579702 mRNA. Translation: CAE30279.1.
AK143019 mRNA. Translation: BAE25250.1.
AC158296 Genomic DNA. No translation available.
AK172937 mRNA. Translation: BAD32215.1.
CCDSiCCDS39982.1. [Q70IV5-1]
CCDS39983.1. [Q70IV5-2]
RefSeqiNP_899135.3. NM_183312.3.
NP_964001.2. NM_201639.2. [Q70IV5-1]
NP_997546.2. NM_207663.3. [Q70IV5-2]
UniGeneiMm.60526.

Genome annotation databases

EnsembliENSMUST00000051389; ENSMUSP00000050987; ENSMUSG00000030554. [Q70IV5-2]
ENSMUST00000074233; ENSMUSP00000073855; ENSMUSG00000030554. [Q70IV5-1]
GeneIDi233335.
KEGGimmu:233335.
UCSCiuc009hiv.1. mouse. [Q70IV5-2]
uc009hiw.1. mouse. [Q70IV5-1]
uc009hix.1. mouse. [Q70IV5-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ579700 mRNA. Translation: CAE30277.1.
AJ579701 mRNA. Translation: CAE30278.1.
AJ579702 mRNA. Translation: CAE30279.1.
AK143019 mRNA. Translation: BAE25250.1.
AC158296 Genomic DNA. No translation available.
AK172937 mRNA. Translation: BAD32215.1.
CCDSiCCDS39982.1. [Q70IV5-1]
CCDS39983.1. [Q70IV5-2]
RefSeqiNP_899135.3. NM_183312.3.
NP_964001.2. NM_201639.2. [Q70IV5-1]
NP_997546.2. NM_207663.3. [Q70IV5-2]
UniGeneiMm.60526.

3D structure databases

ProteinModelPortaliQ70IV5.
SMRiQ70IV5. Positions 251-318.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231405. 1 interaction.
IntActiQ70IV5. 2 interactions.
STRINGi10090.ENSMUSP00000073855.

PTM databases

iPTMnetiQ70IV5.
PhosphoSiteiQ70IV5.

Proteomic databases

MaxQBiQ70IV5.
PaxDbiQ70IV5.
PRIDEiQ70IV5.

Protocols and materials databases

DNASUi233335.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000051389; ENSMUSP00000050987; ENSMUSG00000030554. [Q70IV5-2]
ENSMUST00000074233; ENSMUSP00000073855; ENSMUSG00000030554. [Q70IV5-1]
GeneIDi233335.
KEGGimmu:233335.
UCSCiuc009hiv.1. mouse. [Q70IV5-2]
uc009hiw.1. mouse. [Q70IV5-1]
uc009hix.1. mouse. [Q70IV5-3]

Organism-specific databases

CTDi23336.
MGIiMGI:2661187. Synm.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IH92. Eukaryota.
ENOG4111GBF. LUCA.
GeneTreeiENSGT00730000110953.
HOGENOMiHOG000154476.
HOVERGENiHBG008974.
InParanoidiQ70IV5.
KOiK10376.
OMAiSTPDEYP.
OrthoDBiEOG7W1530.
PhylomeDBiQ70IV5.

Miscellaneous databases

ChiTaRSiSynm. mouse.
NextBioi381683.
PROiQ70IV5.
SOURCEiSearch...

Gene expression databases

BgeeiQ70IV5.
GenevisibleiQ70IV5. MM.

Family and domain databases

InterProiIPR001664. IF.
IPR018039. Intermediate_filament_CS.
IPR030634. SYNM.
[Graphical view]
PANTHERiPTHR23239. PTHR23239. 1 hit.
PTHR23239:SF194. PTHR23239:SF194. 1 hit.
PfamiPF00038. Filament. 1 hit.
[Graphical view]
SMARTiSM01391. Filament. 1 hit.
[Graphical view]
PROSITEiPS00226. IF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The mouse synemin gene encodes three intermediate filament proteins generated by alternative exon usage and different open reading frames."
    Xue Z., Cheraud Y., Brocheriou V., Izmiryan A., Titeux M., Paulin D., Li Z.
    Exp. Cell Res. 298:431-444(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, TISSUE SPECIFICITY.
    Strain: C57BL/6JImported.
    Tissue: Skeletal muscle1 Publication.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6JImported.
    Tissue: LungImported.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H.
    DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 270-1560 (ISOFORM 1).
    Tissue: Embryonic intestineImported.
  5. "Synemin is expressed in reactive astrocytes in neurotrauma and interacts differentially with vimentin and GFAP intermediate filament networks."
    Jing R., Wilhelmsson U., Goodwill W., Li L., Pan Y., Pekny M., Skalli O.
    J. Cell Sci. 120:1267-1277(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH GFAP AND VIM, SUBCELLULAR LOCATION, INDUCTION.
  6. "Synemin isoforms during mouse development: multiplicity of partners in vascular and neuronal systems."
    Izmiryan A., Franco C.A., Paulin D., Li Z., Xue Z.
    Exp. Cell Res. 315:769-783(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEVELOPMENTAL STAGE.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-778; SER-780; SER-1049; SER-1077 AND SER-1087, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Kidney, Lung, Pancreas and Testis.

Entry informationi

Entry nameiSYNEM_MOUSE
AccessioniPrimary (citable) accession number: Q70IV5
Secondary accession number(s): Q3UPZ4
, Q6A081, Q70IV3, Q70IV4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 3, 2009
Last sequence update: March 3, 2009
Last modified: May 11, 2016
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.