Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q70IA6

- MOB2_HUMAN

UniProt

Q70IA6 - MOB2_HUMAN

Protein

MOB kinase activator 2

Gene

MOB2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 90 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Stimulates the autophosphorylation and kinase activity of STK38 and STK38L.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi78 – 781ZincBy similarity
    Metal bindingi83 – 831ZincBy similarity
    Metal bindingi157 – 1571ZincBy similarity
    Metal bindingi162 – 1621ZincBy similarity

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. actin cytoskeleton organization Source: Ensembl
    2. positive regulation of neuron projection development Source: Ensembl
    3. positive regulation of protein phosphorylation Source: Ensembl

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    MOB kinase activator 2
    Alternative name(s):
    HCCA2
    Mob2 homolog
    Mps one binder kinase activator-like 2
    Gene namesi
    Name:MOB2
    Synonyms:HCCA2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:24904. MOB2.

    Subcellular locationi

    Nucleus 1 Publication. Cytoplasmperinuclear region 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. neuron projection terminus Source: Ensembl
    3. nucleolus Source: HPA
    4. nucleus Source: HPA
    5. perinuclear region of cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 237237MOB kinase activator 2PRO_0000193568Add
    BLAST

    Post-translational modificationi

    Phosphorylated.

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ70IA6.
    PaxDbiQ70IA6.
    PRIDEiQ70IA6.

    Expressioni

    Gene expression databases

    BgeeiQ70IA6.
    GenevestigatoriQ70IA6.

    Organism-specific databases

    HPAiHPA046313.

    Interactioni

    Subunit structurei

    Binds STK38 and STK38L.

    Protein-protein interaction databases

    BioGridi123506. 9 interactions.
    IntActiQ70IA6. 4 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ70IA6.
    SMRiQ70IA6. Positions 40-209.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the MOB1/phocein family.Curated

    Phylogenomic databases

    eggNOGiNOG318998.
    HOGENOMiHOG000164685.
    HOVERGENiHBG052489.
    InParanoidiQ70IA6.
    OMAiAHIYSSH.
    OrthoDBiEOG73Z2VF.
    PhylomeDBiQ70IA6.
    TreeFamiTF300789.

    Family and domain databases

    Gene3Di1.20.140.30. 1 hit.
    InterProiIPR005301. Mob1_phocein.
    [Graphical view]
    PANTHERiPTHR22599. PTHR22599. 1 hit.
    PfamiPF03637. Mob1_phocein. 1 hit.
    [Graphical view]
    SUPFAMiSSF101152. SSF101152. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q70IA6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDWLMGKSKA KPNGKKPAAE ERKAYLEPEH TKARITDFQF KELVVLPREI    50
    DLNEWLASNT TTFFHHINLQ YSTISEFCTG ETCQTMAVCN TQYYWYDERG 100
    KKVKCTAPQY VDFVMSSVQK LVTDEDVFPT KYGREFPSSF ESLVRKICRH 150
    LFHVLAHIYW AHFKETLALE LHGHLNTLYV HFILFAREFN LLDPKETAIM 200
    DDLTEVLCSG AGGVHSGGSG DGAGSGGPGA QNHVKER 237
    Length:237
    Mass (Da):26,927
    Last modified:July 5, 2004 - v1
    Checksum:i878A3E6E49294689
    GO
    Isoform 2 (identifier: Q70IA6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         133-142: GREFPSSFES → ENSPAPLSPW
         143-237: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:142
    Mass (Da):16,500
    Checksum:i1C519E331CFE4F56
    GO
    Isoform 3 (identifier: Q70IA6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-6: MDWLMG → MLGDHCSLPEDQARPGQSLQSGLCCKMVLQAVSKVLR

    Show »
    Length:268
    Mass (Da):30,174
    Checksum:i17AFFA11E89352B5
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti49 – 491E → K in BAB71443. (PubMed:14702039)Curated
    Isoform 3 (identifier: Q70IA6-3)
    Sequence conflicti19 – 191L → P in BAG59255. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 66MDWLMG → MLGDHCSLPEDQARPGQSLQ SGLCCKMVLQAVSKVLR in isoform 3. 1 PublicationVSP_044472
    Alternative sequencei133 – 14210GREFPSSFES → ENSPAPLSPW in isoform 2. 1 PublicationVSP_012298
    Alternative sequencei143 – 23795Missing in isoform 2. 1 PublicationVSP_012299Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ580639 mRNA. Translation: CAE45271.1.
    AK057350 mRNA. Translation: BAB71443.1.
    AK296658 mRNA. Translation: BAG59255.1.
    AC091196 Genomic DNA. No translation available.
    BC047291 mRNA. Translation: AAH47291.1.
    BC067785 mRNA. Translation: AAH67785.1.
    CCDSiCCDS53591.1. [Q70IA6-3]
    RefSeqiNP_001165694.1. NM_001172223.2. [Q70IA6-3]
    NP_443731.2. NM_053005.5. [Q70IA6-1]
    UniGeneiHs.370360.

    Genome annotation databases

    EnsembliENST00000329957; ENSP00000328694; ENSG00000182208. [Q70IA6-3]
    GeneIDi81532.
    KEGGihsa:81532.
    UCSCiuc001lto.2. human. [Q70IA6-1]
    uc010qwz.2. human. [Q70IA6-3]

    Polymorphism databases

    DMDMi56749258.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ580639 mRNA. Translation: CAE45271.1 .
    AK057350 mRNA. Translation: BAB71443.1 .
    AK296658 mRNA. Translation: BAG59255.1 .
    AC091196 Genomic DNA. No translation available.
    BC047291 mRNA. Translation: AAH47291.1 .
    BC067785 mRNA. Translation: AAH67785.1 .
    CCDSi CCDS53591.1. [Q70IA6-3 ]
    RefSeqi NP_001165694.1. NM_001172223.2. [Q70IA6-3 ]
    NP_443731.2. NM_053005.5. [Q70IA6-1 ]
    UniGenei Hs.370360.

    3D structure databases

    ProteinModelPortali Q70IA6.
    SMRi Q70IA6. Positions 40-209.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123506. 9 interactions.
    IntActi Q70IA6. 4 interactions.

    Polymorphism databases

    DMDMi 56749258.

    Proteomic databases

    MaxQBi Q70IA6.
    PaxDbi Q70IA6.
    PRIDEi Q70IA6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000329957 ; ENSP00000328694 ; ENSG00000182208 . [Q70IA6-3 ]
    GeneIDi 81532.
    KEGGi hsa:81532.
    UCSCi uc001lto.2. human. [Q70IA6-1 ]
    uc010qwz.2. human. [Q70IA6-3 ]

    Organism-specific databases

    CTDi 81532.
    GeneCardsi GC11M001490.
    HGNCi HGNC:24904. MOB2.
    HPAi HPA046313.
    MIMi 611969. gene.
    neXtProti NX_Q70IA6.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG318998.
    HOGENOMi HOG000164685.
    HOVERGENi HBG052489.
    InParanoidi Q70IA6.
    OMAi AHIYSSH.
    OrthoDBi EOG73Z2VF.
    PhylomeDBi Q70IA6.
    TreeFami TF300789.

    Miscellaneous databases

    ChiTaRSi Mob2. human.
    GenomeRNAii 81532.
    NextBioi 71756.
    PROi Q70IA6.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q70IA6.
    Genevestigatori Q70IA6.

    Family and domain databases

    Gene3Di 1.20.140.30. 1 hit.
    InterProi IPR005301. Mob1_phocein.
    [Graphical view ]
    PANTHERi PTHR22599. PTHR22599. 1 hit.
    Pfami PF03637. Mob1_phocein. 1 hit.
    [Graphical view ]
    SUPFAMi SSF101152. SSF101152. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of the human Mob-1 like proteins."
      Florindo C.S., Tavares A.A.
      Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Colon and Testis.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    5. "Human Mob proteins regulate the NDR1 and NDR2 serine-threonine kinases."
      Devroe E., Erdjument-Bromage H., Tempst P., Silver P.A.
      J. Biol. Chem. 279:24444-24451(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH STK3 AND STK38L, IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiMOB2_HUMAN
    AccessioniPrimary (citable) accession number: Q70IA6
    Secondary accession number(s): B4DKP3, Q96M67
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 21, 2004
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 90 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3