Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q70IA6

- MOB2_HUMAN

UniProt

Q70IA6 - MOB2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

MOB kinase activator 2

Gene

MOB2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Stimulates the autophosphorylation and kinase activity of STK38 and STK38L.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi78 – 781ZincBy similarity
Metal bindingi83 – 831ZincBy similarity
Metal bindingi157 – 1571ZincBy similarity
Metal bindingi162 – 1621ZincBy similarity

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. actin cytoskeleton organization Source: Ensembl
  2. positive regulation of neuron projection development Source: Ensembl
  3. positive regulation of protein phosphorylation Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
MOB kinase activator 2
Alternative name(s):
HCCA2
Mob2 homolog
Mps one binder kinase activator-like 2
Gene namesi
Name:MOB2
Synonyms:HCCA2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:24904. MOB2.

Subcellular locationi

Nucleus 1 Publication. Cytoplasmperinuclear region 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. neuron projection terminus Source: Ensembl
  3. nucleolus Source: HPA
  4. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 237237MOB kinase activator 2PRO_0000193568Add
BLAST

Post-translational modificationi

Phosphorylated.

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ70IA6.
PaxDbiQ70IA6.
PRIDEiQ70IA6.

Expressioni

Gene expression databases

BgeeiQ70IA6.
GenevestigatoriQ70IA6.

Organism-specific databases

HPAiHPA046313.

Interactioni

Subunit structurei

Binds STK38 and STK38L.

Protein-protein interaction databases

BioGridi123506. 9 interactions.
IntActiQ70IA6. 5 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ70IA6.
SMRiQ70IA6. Positions 40-209.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MOB1/phocein family.Curated

Phylogenomic databases

eggNOGiNOG318998.
GeneTreeiENSGT00760000119381.
HOGENOMiHOG000164685.
HOVERGENiHBG052489.
InParanoidiQ70IA6.
OMAiAHIYSSH.
OrthoDBiEOG73Z2VF.
PhylomeDBiQ70IA6.
TreeFamiTF300789.

Family and domain databases

Gene3Di1.20.140.30. 1 hit.
InterProiIPR005301. Mob1_phocein.
[Graphical view]
PANTHERiPTHR22599. PTHR22599. 1 hit.
PfamiPF03637. Mob1_phocein. 1 hit.
[Graphical view]
SUPFAMiSSF101152. SSF101152. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q70IA6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDWLMGKSKA KPNGKKPAAE ERKAYLEPEH TKARITDFQF KELVVLPREI
60 70 80 90 100
DLNEWLASNT TTFFHHINLQ YSTISEFCTG ETCQTMAVCN TQYYWYDERG
110 120 130 140 150
KKVKCTAPQY VDFVMSSVQK LVTDEDVFPT KYGREFPSSF ESLVRKICRH
160 170 180 190 200
LFHVLAHIYW AHFKETLALE LHGHLNTLYV HFILFAREFN LLDPKETAIM
210 220 230
DDLTEVLCSG AGGVHSGGSG DGAGSGGPGA QNHVKER
Length:237
Mass (Da):26,927
Last modified:July 5, 2004 - v1
Checksum:i878A3E6E49294689
GO
Isoform 2 (identifier: Q70IA6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-142: GREFPSSFES → ENSPAPLSPW
     143-237: Missing.

Note: No experimental confirmation available.

Show »
Length:142
Mass (Da):16,500
Checksum:i1C519E331CFE4F56
GO
Isoform 3 (identifier: Q70IA6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MDWLMG → MLGDHCSLPEDQARPGQSLQSGLCCKMVLQAVSKVLR

Show »
Length:268
Mass (Da):30,174
Checksum:i17AFFA11E89352B5
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti49 – 491E → K in BAB71443. (PubMed:14702039)Curated
Isoform 3 (identifier: Q70IA6-3)
Sequence conflicti19 – 191L → P in BAG59255. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 66MDWLMG → MLGDHCSLPEDQARPGQSLQ SGLCCKMVLQAVSKVLR in isoform 3. 1 PublicationVSP_044472
Alternative sequencei133 – 14210GREFPSSFES → ENSPAPLSPW in isoform 2. 1 PublicationVSP_012298
Alternative sequencei143 – 23795Missing in isoform 2. 1 PublicationVSP_012299Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ580639 mRNA. Translation: CAE45271.1.
AK057350 mRNA. Translation: BAB71443.1.
AK296658 mRNA. Translation: BAG59255.1.
AC091196 Genomic DNA. No translation available.
BC047291 mRNA. Translation: AAH47291.1.
BC067785 mRNA. Translation: AAH67785.1.
CCDSiCCDS53591.1. [Q70IA6-3]
RefSeqiNP_001165694.1. NM_001172223.2. [Q70IA6-3]
NP_443731.2. NM_053005.5. [Q70IA6-1]
UniGeneiHs.370360.

Genome annotation databases

EnsembliENST00000329957; ENSP00000328694; ENSG00000182208. [Q70IA6-3]
GeneIDi81532.
KEGGihsa:81532.
UCSCiuc001lto.2. human. [Q70IA6-1]
uc010qwz.2. human. [Q70IA6-3]

Polymorphism databases

DMDMi56749258.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ580639 mRNA. Translation: CAE45271.1 .
AK057350 mRNA. Translation: BAB71443.1 .
AK296658 mRNA. Translation: BAG59255.1 .
AC091196 Genomic DNA. No translation available.
BC047291 mRNA. Translation: AAH47291.1 .
BC067785 mRNA. Translation: AAH67785.1 .
CCDSi CCDS53591.1. [Q70IA6-3 ]
RefSeqi NP_001165694.1. NM_001172223.2. [Q70IA6-3 ]
NP_443731.2. NM_053005.5. [Q70IA6-1 ]
UniGenei Hs.370360.

3D structure databases

ProteinModelPortali Q70IA6.
SMRi Q70IA6. Positions 40-209.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123506. 9 interactions.
IntActi Q70IA6. 5 interactions.

Polymorphism databases

DMDMi 56749258.

Proteomic databases

MaxQBi Q70IA6.
PaxDbi Q70IA6.
PRIDEi Q70IA6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000329957 ; ENSP00000328694 ; ENSG00000182208 . [Q70IA6-3 ]
GeneIDi 81532.
KEGGi hsa:81532.
UCSCi uc001lto.2. human. [Q70IA6-1 ]
uc010qwz.2. human. [Q70IA6-3 ]

Organism-specific databases

CTDi 81532.
GeneCardsi GC11M001490.
HGNCi HGNC:24904. MOB2.
HPAi HPA046313.
MIMi 611969. gene.
neXtProti NX_Q70IA6.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG318998.
GeneTreei ENSGT00760000119381.
HOGENOMi HOG000164685.
HOVERGENi HBG052489.
InParanoidi Q70IA6.
OMAi AHIYSSH.
OrthoDBi EOG73Z2VF.
PhylomeDBi Q70IA6.
TreeFami TF300789.

Miscellaneous databases

ChiTaRSi Mob2. human.
GenomeRNAii 81532.
NextBioi 71756.
PROi Q70IA6.
SOURCEi Search...

Gene expression databases

Bgeei Q70IA6.
Genevestigatori Q70IA6.

Family and domain databases

Gene3Di 1.20.140.30. 1 hit.
InterProi IPR005301. Mob1_phocein.
[Graphical view ]
PANTHERi PTHR22599. PTHR22599. 1 hit.
Pfami PF03637. Mob1_phocein. 1 hit.
[Graphical view ]
SUPFAMi SSF101152. SSF101152. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of the human Mob-1 like proteins."
    Florindo C.S., Tavares A.A.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Colon and Testis.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  5. "Human Mob proteins regulate the NDR1 and NDR2 serine-threonine kinases."
    Devroe E., Erdjument-Bromage H., Tempst P., Silver P.A.
    J. Biol. Chem. 279:24444-24451(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH STK3 AND STK38L, IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiMOB2_HUMAN
AccessioniPrimary (citable) accession number: Q70IA6
Secondary accession number(s): B4DKP3, Q96M67
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 21, 2004
Last sequence update: July 5, 2004
Last modified: October 29, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3