Q70IA6 (MOB2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: MOB kinase activator 2 Alternative name(s): HCCA2 Mob2 homolog Mps one binder kinase activator-like 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 237 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Stimulates the autophosphorylation and kinase activity of STK38 and STK38L. Ref.4 |
| Subunit structure | Binds STK38 and STK38L. |
| Subcellular location | |
| Post-translational modification | Phosphorylated. |
| Sequence similarities | Belongs to the MOB1/phocein family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA nucleolusInferred from direct assay. Source: HPA perinuclear region of cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q70IA6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q70IA6-2) The sequence of this isoform differs from the canonical sequence as follows: 133-142: GREFPSSFES → ENSPAPLSPW 143-237: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q70IA6-3) The sequence of this isoform differs from the canonical sequence as follows: 1-6: MDWLMG → MLGDHCSLPEDQARPGQSPQSGLCCKMVLQAVSKVLR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 237 | 237 | MOB kinase activator 2 | PRO_0000193568 | |||||
Sites | |||||||||
| Metal binding | 78 | 1 | Zinc By similarity | ||||||
| Metal binding | 83 | 1 | Zinc By similarity | ||||||
| Metal binding | 157 | 1 | Zinc By similarity | ||||||
| Metal binding | 162 | 1 | Zinc By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 6 | 6 | MDWLMG → MLGDHCSLPEDQARPGQSPQ SGLCCKMVLQAVSKVLR in isoform 3. | VSP_044472 | |||||
| Alternative sequence | 133 – 142 | 10 | GREFPSSFES → ENSPAPLSPW in isoform 2. | VSP_012298 | |||||
| Alternative sequence | 143 – 237 | 95 | Missing in isoform 2. | VSP_012299 | |||||
Experimental info | |||||||||
| Sequence conflict | 49 | 1 | E → K in BAB71443. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the human Mob-1 like proteins." Florindo C.S., Tavares A.A. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Colon and Testis. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "Human Mob proteins regulate the NDR1 and NDR2 serine-threonine kinases." Devroe E., Erdjument-Bromage H., Tempst P., Silver P.A. J. Biol. Chem. 279:24444-24451(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH STK3 AND STK38L, MASS SPECTROMETRY, SUBCELLULAR LOCATION. |
| [5] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ580639 mRNA. Translation: CAE45271.1. AK057350 mRNA. Translation: BAB71443.1. AK296658 mRNA. Translation: BAG59255.1. BC047291 mRNA. Translation: AAH47291.1. BC067785 mRNA. Translation: AAH67785.1. |
| IPI | IPI00418248. IPI00514453. IPI00939594. |
| RefSeq | NP_001165694.1. NM_001172223.1. NP_443731.2. NM_053005.4. |
| UniGene | Hs.370360. |
3D structure databases | |
| ProteinModelPortal | Q70IA6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q70IA6. 1 interaction. |
Polymorphism databases | |
| DMDM | 56749258. |
Proteomic databases | |
| PaxDb | Q70IA6. |
| PRIDE | Q70IA6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000329957; ENSP00000328694; ENSG00000182208. |
| GeneID | 81532. |
| KEGG | hsa:81532. |
| UCSC | uc001lto.2. human. |
Organism-specific databases | |
| CTD | 81532. |
| GeneCards | GC11M001490. |
| HGNC | HGNC:24904. MOB2. |
| HPA | HPA046313. |
| MIM | 611969. gene. |
| neXtProt | NX_Q70IA6. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG318998. |
| HOGENOM | HOG000164685. |
| HOVERGEN | HBG052489. |
| InParanoid | Q70IA6. |
Gene expression databases | |
| Bgee | Q70IA6. |
| Genevestigator | Q70IA6. |
| GermOnline | ENSG00000182208. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.140.30. 1 hit. |
| InterPro | IPR005301. Mob1_phocein. [Graphical view] |
| PANTHER | PTHR22599. PTHR22599. 1 hit. |
| Pfam | PF03637. Mob1_phocein. 1 hit. [Graphical view] |
| SUPFAM | SSF101152. Mob1_phocein. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | Mob2. human. |
| GenomeRNAi | 81532. |
| NextBio | 71756. |
| SOURCE | Search... |
Entry information
| Entry name | MOB2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q70IA6 Secondary accession number(s): B4DKP3, Q96M67 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
