Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q70IA6 (MOB2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
MOB kinase activator 2
Alternative name(s):
HCCA2
Mob2 homolog
Mps one binder kinase activator-like 2
Gene names
Name:MOB2
Synonyms:HCCA2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length237 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Stimulates the autophosphorylation and kinase activity of STK38 and STK38L. Ref.5

Subunit structure

Binds STK38 and STK38L.

Subcellular location

Nucleus. Cytoplasmperinuclear region Ref.5.

Post-translational modification

Phosphorylated.

Sequence similarities

Belongs to the MOB1/phocein family.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q70IA6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q70IA6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     133-142: GREFPSSFES → ENSPAPLSPW
     143-237: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q70IA6-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MDWLMG → MLGDHCSLPEDQARPGQSLQSGLCCKMVLQAVSKVLR

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 237237MOB kinase activator 2
PRO_0000193568

Sites

Metal binding781Zinc By similarity
Metal binding831Zinc By similarity
Metal binding1571Zinc By similarity
Metal binding1621Zinc By similarity

Natural variations

Alternative sequence1 – 66MDWLMG → MLGDHCSLPEDQARPGQSLQ SGLCCKMVLQAVSKVLR in isoform 3.
VSP_044472
Alternative sequence133 – 14210GREFPSSFES → ENSPAPLSPW in isoform 2.
VSP_012298
Alternative sequence143 – 23795Missing in isoform 2.
VSP_012299

Experimental info

Sequence conflict491E → K in BAB71443. Ref.2
Isoform 3:
Sequence conflict191L → P in BAG59255. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 878A3E6E49294689

FASTA23726,927
        10         20         30         40         50         60 
MDWLMGKSKA KPNGKKPAAE ERKAYLEPEH TKARITDFQF KELVVLPREI DLNEWLASNT 

        70         80         90        100        110        120 
TTFFHHINLQ YSTISEFCTG ETCQTMAVCN TQYYWYDERG KKVKCTAPQY VDFVMSSVQK 

       130        140        150        160        170        180 
LVTDEDVFPT KYGREFPSSF ESLVRKICRH LFHVLAHIYW AHFKETLALE LHGHLNTLYV 

       190        200        210        220        230 
HFILFAREFN LLDPKETAIM DDLTEVLCSG AGGVHSGGSG DGAGSGGPGA QNHVKER 

« Hide

Isoform 2 [UniParc].

Checksum: 1C519E331CFE4F56
Show »

FASTA14216,500
Isoform 3 [UniParc].

Checksum: 17AFFA11E89352B5
Show »

FASTA26830,174

References

« Hide 'large scale' references
[1]"Characterization of the human Mob-1 like proteins."
Florindo C.S., Tavares A.A.
Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Colon and Testis.
[3]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[5]"Human Mob proteins regulate the NDR1 and NDR2 serine-threonine kinases."
Devroe E., Erdjument-Bromage H., Tempst P., Silver P.A.
J. Biol. Chem. 279:24444-24451(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH STK3 AND STK38L, IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
[6]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ580639 mRNA. Translation: CAE45271.1.
AK057350 mRNA. Translation: BAB71443.1.
AK296658 mRNA. Translation: BAG59255.1.
AC091196 Genomic DNA. No translation available.
BC047291 mRNA. Translation: AAH47291.1.
BC067785 mRNA. Translation: AAH67785.1.
RefSeqNP_001165694.1. NM_001172223.1.
NP_443731.2. NM_053005.4.
UniGeneHs.370360.

3D structure databases

ProteinModelPortalQ70IA6.
SMRQ70IA6. Positions 40-209.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123506. 8 interactions.
IntActQ70IA6. 4 interactions.

Polymorphism databases

DMDM56749258.

Proteomic databases

PaxDbQ70IA6.
PRIDEQ70IA6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000329957; ENSP00000328694; ENSG00000182208. [Q70IA6-3]
GeneID81532.
KEGGhsa:81532.
UCSCuc001lto.2. human. [Q70IA6-1]
uc010qwz.2. human. [Q70IA6-3]

Organism-specific databases

CTD81532.
GeneCardsGC11M001490.
HGNCHGNC:24904. MOB2.
HPAHPA046313.
MIM611969. gene.
neXtProtNX_Q70IA6.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG318998.
HOGENOMHOG000164685.
HOVERGENHBG052489.
InParanoidQ70IA6.
OrthoDBEOG73Z2VF.
PhylomeDBQ70IA6.
TreeFamTF300789.

Gene expression databases

BgeeQ70IA6.
GenevestigatorQ70IA6.

Family and domain databases

Gene3D1.20.140.30. 1 hit.
InterProIPR005301. Mob1_phocein.
[Graphical view]
PANTHERPTHR22599. PTHR22599. 1 hit.
PfamPF03637. Mob1_phocein. 1 hit.
[Graphical view]
SUPFAMSSF101152. SSF101152. 1 hit.
ProtoNetSearch...

Other

ChiTaRSMob2. human.
GenomeRNAi81532.
NextBio71756.
PROQ70IA6.
SOURCESearch...

Entry information

Entry nameMOB2_HUMAN
AccessionPrimary (citable) accession number: Q70IA6
Secondary accession number(s): B4DKP3, Q96M67
Entry history
Integrated into UniProtKB/Swiss-Prot: December 21, 2004
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM