Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MOB kinase activator 2

Gene

MOB2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Stimulates the autophosphorylation and kinase activity of STK38 and STK38L.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi78ZincBy similarity1
Metal bindingi83ZincBy similarity1
Metal bindingi157ZincBy similarity1
Metal bindingi162ZincBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
MOB kinase activator 2
Alternative name(s):
HCCA2
Mob2 homolog
Mps one binder kinase activator-like 2
Gene namesi
Name:MOB2
Synonyms:HCCA2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:24904. MOB2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi81532.
OpenTargetsiENSG00000182208.

Polymorphism and mutation databases

BioMutaiMOB2.
DMDMi56749258.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001935681 – 237MOB kinase activator 2Add BLAST237

Post-translational modificationi

Phosphorylated.

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ70IA6.
MaxQBiQ70IA6.
PaxDbiQ70IA6.
PeptideAtlasiQ70IA6.
PRIDEiQ70IA6.

PTM databases

PhosphoSitePlusiQ70IA6.

Expressioni

Gene expression databases

BgeeiENSG00000182208.
ExpressionAtlasiQ70IA6. baseline and differential.

Organism-specific databases

HPAiHPA046313.

Interactioni

Subunit structurei

Binds STK38 and STK38L.

Protein-protein interaction databases

BioGridi123506. 10 interactors.
IntActiQ70IA6. 8 interactors.
STRINGi9606.ENSP00000328694.

Structurei

3D structure databases

ProteinModelPortaliQ70IA6.
SMRiQ70IA6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MOB1/phocein family.Curated

Phylogenomic databases

eggNOGiKOG0440. Eukaryota.
ENOG410XSUJ. LUCA.
GeneTreeiENSGT00550000074456.
HOGENOMiHOG000164685.
HOVERGENiHBG052489.
InParanoidiQ70IA6.
OMAiHTKSRIT.
OrthoDBiEOG091G0MET.
PhylomeDBiQ70IA6.
TreeFamiTF300789.

Family and domain databases

Gene3Di1.20.140.30. 1 hit.
InterProiIPR005301. MOB_kinase_act_fam.
[Graphical view]
PANTHERiPTHR22599. PTHR22599. 1 hit.
PfamiPF03637. Mob1_phocein. 1 hit.
[Graphical view]
SMARTiSM01388. Mob1_phocein. 1 hit.
[Graphical view]
SUPFAMiSSF101152. SSF101152. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q70IA6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDWLMGKSKA KPNGKKPAAE ERKAYLEPEH TKARITDFQF KELVVLPREI
60 70 80 90 100
DLNEWLASNT TTFFHHINLQ YSTISEFCTG ETCQTMAVCN TQYYWYDERG
110 120 130 140 150
KKVKCTAPQY VDFVMSSVQK LVTDEDVFPT KYGREFPSSF ESLVRKICRH
160 170 180 190 200
LFHVLAHIYW AHFKETLALE LHGHLNTLYV HFILFAREFN LLDPKETAIM
210 220 230
DDLTEVLCSG AGGVHSGGSG DGAGSGGPGA QNHVKER
Length:237
Mass (Da):26,927
Last modified:July 5, 2004 - v1
Checksum:i878A3E6E49294689
GO
Isoform 2 (identifier: Q70IA6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-142: GREFPSSFES → ENSPAPLSPW
     143-237: Missing.

Note: No experimental confirmation available.
Show »
Length:142
Mass (Da):16,500
Checksum:i1C519E331CFE4F56
GO
Isoform 3 (identifier: Q70IA6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MDWLMG → MLGDHCSLPEDQARPGQSLQSGLCCKMVLQAVSKVLR

Show »
Length:268
Mass (Da):30,174
Checksum:i17AFFA11E89352B5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti49E → K in BAB71443 (PubMed:14702039).Curated1
Isoform 3 (identifier: Q70IA6-3)
Sequence conflicti19L → P in BAG59255 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0444721 – 6MDWLMG → MLGDHCSLPEDQARPGQSLQ SGLCCKMVLQAVSKVLR in isoform 3. 1 Publication6
Alternative sequenceiVSP_012298133 – 142GREFPSSFES → ENSPAPLSPW in isoform 2. 1 Publication10
Alternative sequenceiVSP_012299143 – 237Missing in isoform 2. 1 PublicationAdd BLAST95

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ580639 mRNA. Translation: CAE45271.1.
AK057350 mRNA. Translation: BAB71443.1.
AK296658 mRNA. Translation: BAG59255.1.
AC091196 Genomic DNA. No translation available.
BC047291 mRNA. Translation: AAH47291.1.
BC067785 mRNA. Translation: AAH67785.1.
CCDSiCCDS53591.1. [Q70IA6-3]
RefSeqiNP_001165694.1. NM_001172223.2. [Q70IA6-3]
NP_443731.2. NM_053005.5. [Q70IA6-1]
UniGeneiHs.370360.

Genome annotation databases

EnsembliENST00000329957; ENSP00000328694; ENSG00000182208. [Q70IA6-3]
GeneIDi81532.
KEGGihsa:81532.
UCSCiuc010qwz.3. human. [Q70IA6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ580639 mRNA. Translation: CAE45271.1.
AK057350 mRNA. Translation: BAB71443.1.
AK296658 mRNA. Translation: BAG59255.1.
AC091196 Genomic DNA. No translation available.
BC047291 mRNA. Translation: AAH47291.1.
BC067785 mRNA. Translation: AAH67785.1.
CCDSiCCDS53591.1. [Q70IA6-3]
RefSeqiNP_001165694.1. NM_001172223.2. [Q70IA6-3]
NP_443731.2. NM_053005.5. [Q70IA6-1]
UniGeneiHs.370360.

3D structure databases

ProteinModelPortaliQ70IA6.
SMRiQ70IA6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123506. 10 interactors.
IntActiQ70IA6. 8 interactors.
STRINGi9606.ENSP00000328694.

PTM databases

PhosphoSitePlusiQ70IA6.

Polymorphism and mutation databases

BioMutaiMOB2.
DMDMi56749258.

Proteomic databases

EPDiQ70IA6.
MaxQBiQ70IA6.
PaxDbiQ70IA6.
PeptideAtlasiQ70IA6.
PRIDEiQ70IA6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329957; ENSP00000328694; ENSG00000182208. [Q70IA6-3]
GeneIDi81532.
KEGGihsa:81532.
UCSCiuc010qwz.3. human. [Q70IA6-1]

Organism-specific databases

CTDi81532.
DisGeNETi81532.
GeneCardsiMOB2.
HGNCiHGNC:24904. MOB2.
HPAiHPA046313.
MIMi611969. gene.
neXtProtiNX_Q70IA6.
OpenTargetsiENSG00000182208.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0440. Eukaryota.
ENOG410XSUJ. LUCA.
GeneTreeiENSGT00550000074456.
HOGENOMiHOG000164685.
HOVERGENiHBG052489.
InParanoidiQ70IA6.
OMAiHTKSRIT.
OrthoDBiEOG091G0MET.
PhylomeDBiQ70IA6.
TreeFamiTF300789.

Miscellaneous databases

ChiTaRSiMOB2. human.
GenomeRNAii81532.
PROiQ70IA6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000182208.
ExpressionAtlasiQ70IA6. baseline and differential.

Family and domain databases

Gene3Di1.20.140.30. 1 hit.
InterProiIPR005301. MOB_kinase_act_fam.
[Graphical view]
PANTHERiPTHR22599. PTHR22599. 1 hit.
PfamiPF03637. Mob1_phocein. 1 hit.
[Graphical view]
SMARTiSM01388. Mob1_phocein. 1 hit.
[Graphical view]
SUPFAMiSSF101152. SSF101152. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMOB2_HUMAN
AccessioniPrimary (citable) accession number: Q70IA6
Secondary accession number(s): B4DKP3, Q96M67
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 21, 2004
Last sequence update: July 5, 2004
Last modified: November 30, 2016
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.