Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-associated and pleckstrin homology domains-containing protein 1

Gene

RAPH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mediator of localized membrane signals. Implicated in the regulation of lamellipodial dynamics. Negatively regulates cell adhesion.

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000173166-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-associated and pleckstrin homology domains-containing protein 1
Short name:
RAPH1
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 18 protein
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 9 protein
Lamellipodin
Proline-rich EVH1 ligand 2
Short name:
PREL-2
Protein RMO1
Gene namesi
Name:RAPH1
Synonyms:ALS2CR18, ALS2CR9, KIAA1681, LPD, PREL2, RMO1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:14436. RAPH1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi65059.
OpenTargetsiENSG00000173166.
PharmGKBiPA24749.

Polymorphism and mutation databases

BioMutaiRAPH1.
DMDMi215274220.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001813521 – 1250Ras-associated and pleckstrin homology domains-containing protein 1Add BLAST1250

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei5PhosphoserineCombined sources1
Modified residuei17PhosphoserineCombined sources1
Modified residuei54PhosphoserineCombined sources1
Modified residuei150PhosphoserineCombined sources1
Modified residuei192PhosphoserineCombined sources1
Modified residuei203PhosphoserineCombined sources1
Modified residuei205PhosphoserineCombined sources1
Modified residuei426Phosphotyrosine; by ABL11 Publication1
Modified residuei456Phosphotyrosine; by ABL11 Publication1
Modified residuei610PhosphoserineCombined sources1
Modified residuei827PhosphoserineCombined sources1
Modified residuei830PhosphothreonineCombined sources1
Modified residuei845PhosphoserineCombined sources1
Modified residuei853PhosphoserineCombined sources1
Modified residuei894PhosphoserineCombined sources1
Modified residuei965PhosphoserineCombined sources1
Modified residuei974PhosphothreonineCombined sources1
Modified residuei996PhosphoserineCombined sources1
Modified residuei1012PhosphoserineCombined sources1
Modified residuei1183PhosphoserineCombined sources1
Modified residuei1226Phosphotyrosine; by ABL11 Publication1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ70E73.
PaxDbiQ70E73.
PeptideAtlasiQ70E73.
PRIDEiQ70E73.

PTM databases

iPTMnetiQ70E73.
PhosphoSitePlusiQ70E73.

Expressioni

Tissue specificityi

Isoform RMO1-RAPH1 is ubiquitously expressed with highest levels in brain, heart, ovary and developing embryo. Isoform RMO1 is widely expressed with highest levels in liver. Low expression in B-cells.2 Publications

Inductioni

Reduced expression in metastatic osteosarcomas compared to primary osteosarcoma tumors. Down-regulated in both breast (43% of tissue samples) and ovarian (25% of tissue samples) cancers.

Gene expression databases

BgeeiENSG00000173166.
CleanExiHS_RAPH1.
ExpressionAtlasiQ70E73. baseline and differential.
GenevisibleiQ70E73. HS.

Organism-specific databases

HPAiHPA016744.
HPA020027.

Interactioni

Subunit structurei

Interacts with EVL and VASP and targets them to the leading edge (PubMed:15469845). Interacts (via Ras associating and PH domains) with RAC1 (PubMed:18499456).2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
EGFRP005332EBI-3940924,EBI-297353
Sh3gl1O3596413EBI-3940924,EBI-1149235From a different organism.
SH3GL2Q999624EBI-3940924,EBI-77938
SH3GL3Q999634EBI-3940924,EBI-473910

Protein-protein interaction databases

BioGridi122380. 14 interactors.
DIPiDIP-61336N.
IntActiQ70E73. 8 interactors.
STRINGi9606.ENSP00000316543.

Structurei

Secondary structure

11250
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi255 – 264Combined sources10
Beta strandi270 – 276Combined sources7
Beta strandi282 – 288Combined sources7
Helixi293 – 304Combined sources12
Beta strandi312 – 318Combined sources7
Helixi319 – 321Combined sources3
Beta strandi323 – 326Combined sources4
Helixi333 – 337Combined sources5
Beta strandi348 – 352Combined sources5
Helixi354 – 356Combined sources3
Helixi358 – 361Combined sources4
Helixi363 – 365Combined sources3
Helixi378 – 389Combined sources12
Beta strandi390 – 393Combined sources4
Beta strandi400 – 406Combined sources7
Beta strandi413 – 421Combined sources9
Beta strandi424 – 427Combined sources4
Beta strandi429 – 433Combined sources5
Helixi436 – 438Combined sources3
Beta strandi440 – 443Combined sources4
Helixi445 – 447Combined sources3
Beta strandi449 – 455Combined sources7
Helixi456 – 459Combined sources4
Beta strandi463 – 465Combined sources3
Beta strandi467 – 471Combined sources5
Beta strandi483 – 486Combined sources4
Helixi490 – 505Combined sources16
Helixi507 – 516Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4GMVX-ray2.40A/B240-520[»]
4GN1X-ray2.40A/B/C/D266-520[»]
ProteinModelPortaliQ70E73.
SMRiQ70E73.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini269 – 355Ras-associatingPROSITE-ProRule annotationAdd BLAST87
Domaini396 – 505PHPROSITE-ProRule annotationAdd BLAST110

Sequence similaritiesi

Belongs to the MRL family.Curated
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 Ras-associating domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3751. Eukaryota.
ENOG410XXC8. LUCA.
GeneTreeiENSGT00550000074537.
HOGENOMiHOG000154072.
HOVERGENiHBG089219.
InParanoidiQ70E73.
PhylomeDBiQ70E73.
TreeFamiTF317511.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR000159. RA_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00788. RA. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00314. RA. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50200. RA. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform RMO1-RAPH1 (identifier: Q70E73-10) [UniParc]FASTAAdd to basket
Also known as: Lamellipodin, RAPH1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEQLSDEEID HGAEEDSDKE DQDLDKMFGA WLGELDKLTQ SLDSDKPMEP
60 70 80 90 100
VKRSPLRQET NMANFSYRFS IYNLNEALNQ GETVDLDALM ADLCSIEQEL
110 120 130 140 150
SSIGSGNSKR QITETKATQK LPVSRHTLKH GTLKGLSSSS NRIAKPSHAS
160 170 180 190 200
YSLDDVTAQL EQASLSMDEA AQQSVLEDTK PLVTNQHRRT ASAGTVSDAE
210 220 230 240 250
VHSISNSSHS SITSAASSMD SLDIDKVTRP QELDLTHQGQ PITEEEQAAK
260 270 280 290 300
LKAEKIRVAL EKIKEAQVKK LVIRVHMSDD SSKTMMVDER QTVRQVLDNL
310 320 330 340 350
MDKSHCGYSL DWSLVETVSE LQMERIFEDH ENLVENLLNW TRDSQNKLIF
360 370 380 390 400
MERIEKYALF KNPQNYLLGK KETAEMADRN KEVLLEECFC GSSVTVPEIE
410 420 430 440 450
GVLWLKDDGK KSWKKRYFLL RASGIYYVPK GKAKVSRDLV CFLQLDHVNV
460 470 480 490 500
YYGQDYRNKY KAPTDYCLVL KHPQIQKKSQ YIKYLCCDDV RTLHQWVNGI
510 520 530 540 550
RIAKYGKQLY MNYQEALKRT ESAYDWTSLS SSSIKSGSSS SSIPESQSNH
560 570 580 590 600
SNQSDSGVSD TQPAGHVRSQ SIVSSVFSEA WKRGTQLEES SKARMESMNR
610 620 630 640 650
PYTSLVPPLS PQPKIVTPYT ASQPSPPLPP PPPPPPPPPP PPPPPPPPLP
660 670 680 690 700
SQSAPSAGSA APMFVKYSTI TRLQNASQHS GALFKPPTPP VMQSQSVKPQ
710 720 730 740 750
ILVPPNGVVP PPPPPPPPPT PGSAMAQLKP APCAPSLPQF SAPPPPLKIH
760 770 780 790 800
QVQHITQVAP PTPPPPPPIP APLPPQAPPK PLVTIPAPTS TKTVAPVVTQ
810 820 830 840 850
AAPPTPTPPV PPAKKQPAFP ASYIPPSPPT PPVPVPPPTL PKQQSFCAKP
860 870 880 890 900
PPSPLSPVPS VVKQIASQFP PPPTPPAMES QPLKPVPANV APQSPPAVKA
910 920 930 940 950
KPKWQPSSIP VPSPDFPPPP PESSLVFPPP PPSPVPAPPP PPPPTASPTP
960 970 980 990 1000
DKSGSPGKKT SKTSSPGGKK PPPTPQRNSS IKSSSGAEHP EPKRPSVDSL
1010 1020 1030 1040 1050
VSKFTPPAES GSPSKETLPP PAAPPKPGKL NLSGVNLPGV LQQGCVSAKA
1060 1070 1080 1090 1100
PVLSGRGKDS VVEFPSPPSD SDFPPPPPET ELPLPPIEIP AVFSGNTSPK
1110 1120 1130 1140 1150
VAVVNPQPQQ WSKMSVKKAP PPTRPKRNDS TRLTQAEISE QPTMATVVPQ
1160 1170 1180 1190 1200
VPTSPKSSLS VQPGFLADLN RTLQRKSITR HGSLSSRMSR AEPTATMDDM
1210 1220 1230 1240 1250
ALPPPPPELL SDQQKAGYGG SHISGYATLR RGPPPAPPKR DQNTKLSRDW
Length:1,250
Mass (Da):135,256
Last modified:November 25, 2008 - v3
Checksum:i1DFB651F945DA3DC
GO
Isoform RMO1 (identifier: Q70E73-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-597: ARMES → VTASF
     598-1250: Missing.

Show »
Length:597
Mass (Da):67,456
Checksum:i75BDB66A42373617
GO
Isoform RMO1a (identifier: Q70E73-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHAISLRCSSKQAKRHIDFTEEQAELTP
     593-597: ARMES → VTASF
     598-1250: Missing.

Show »
Length:624
Mass (Da):70,534
Checksum:i64CEFFB3F5491DBE
GO
Isoform RMO1b (identifier: Q70E73-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHSYLDRETSLLLRNIAGKPSHLLTK
     593-597: ARMES → VTASF
     598-1250: Missing.

Show »
Length:622
Mass (Da):70,301
Checksum:iD4492E1C4D82C239
GO
Isoform RMO1c (identifier: Q70E73-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-1250: Missing.

Show »
Length:592
Mass (Da):66,950
Checksum:i07361715124582FF
GO
Isoform RMO1ab (identifier: Q70E73-6) [UniParc]FASTAAdd to basket
Also known as: Lamellipodin-S, Lpd-S

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHAISLRCSSKQAKRHIDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTK
     593-597: ARMES → VTASF
     598-1250: Missing.

Show »
Length:649
Mass (Da):73,379
Checksum:i3B54297D886F095B
GO
Isoform RMO1ac (identifier: Q70E73-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHAISLRCSSKQAKRHIDFTEEQAELTP
     593-1250: Missing.

Show »
Length:619
Mass (Da):70,028
Checksum:i691DBE08F3FC2768
GO
Isoform RMO1bc (identifier: Q70E73-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHSYLDRETSLLLRNIAGKPSHLLTK
     593-1250: Missing.

Show »
Length:617
Mass (Da):69,795
Checksum:iE2C239CF09D9A2F4
GO
Isoform RMO1abc (identifier: Q70E73-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHAISLRCSSKQAKRHIDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTK
     593-1250: Missing.

Show »
Length:644
Mass (Da):72,874
Checksum:iBF095B6EDA528735
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1081E → D in AAS82582 (PubMed:15469845).Curated1
Sequence conflicti1081E → D in CAE48361 (PubMed:15586368).Curated1
Sequence conflicti1081E → D in BAB21772 (PubMed:11214970).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036009891A → S in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_0360101228T → A in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_035784244E → EHAISLRCSSKQAKRHIDFT EEQAELTP in isoform RMO1a and isoform RMO1ac. Curated1
Alternative sequenceiVSP_035785244E → EHAISLRCSSKQAKRHIDFT EEQAELTPHSYLDRETSLLL RNIAGKPSHLLTK in isoform RMO1ab and isoform RMO1abc. 2 Publications1
Alternative sequenceiVSP_035786244E → EHSYLDRETSLLLRNIAGKP SHLLTK in isoform RMO1b and isoform RMO1bc. Curated1
Alternative sequenceiVSP_035787593 – 1250Missing in isoform RMO1c, isoform RMO1ac, isoform RMO1bc and isoform RMO1abc. 1 PublicationAdd BLAST658
Alternative sequenceiVSP_035788593 – 597ARMES → VTASF in isoform RMO1, isoform RMO1a, isoform RMO1b and isoform RMO1ab. 2 Publications5
Alternative sequenceiVSP_035789598 – 1250Missing in isoform RMO1, isoform RMO1a, isoform RMO1b and isoform RMO1ab. 2 PublicationsAdd BLAST653

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053311 mRNA. Translation: BAB69020.1.
AY494951 mRNA. Translation: AAS82582.1.
AY523977 mRNA. Translation: AAS16935.1.
AY523978 mRNA. Translation: AAS16936.1.
AJ584699 mRNA. Translation: CAE48361.1.
AC018891 Genomic DNA. Translation: AAY14676.1.
AB051468 mRNA. Translation: BAB21772.1.
CCDSiCCDS2359.1. [Q70E73-10]
CCDS2360.1. [Q70E73-9]
RefSeqiNP_976241.1. NM_203365.3. [Q70E73-9]
NP_998754.1. NM_213589.2. [Q70E73-10]
UniGeneiHs.471162.

Genome annotation databases

EnsembliENST00000308091; ENSP00000311293; ENSG00000173166. [Q70E73-9]
ENST00000319170; ENSP00000316543; ENSG00000173166. [Q70E73-10]
ENST00000418114; ENSP00000396711; ENSG00000173166. [Q70E73-2]
ENST00000419464; ENSP00000390578; ENSG00000173166. [Q70E73-5]
ENST00000423104; ENSP00000397751; ENSG00000173166. [Q70E73-7]
ENST00000439222; ENSP00000411138; ENSG00000173166. [Q70E73-8]
ENST00000453034; ENSP00000406662; ENSG00000173166. [Q70E73-6]
GeneIDi65059.
KEGGihsa:65059.
UCSCiuc002vad.5. human. [Q70E73-10]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053311 mRNA. Translation: BAB69020.1.
AY494951 mRNA. Translation: AAS82582.1.
AY523977 mRNA. Translation: AAS16935.1.
AY523978 mRNA. Translation: AAS16936.1.
AJ584699 mRNA. Translation: CAE48361.1.
AC018891 Genomic DNA. Translation: AAY14676.1.
AB051468 mRNA. Translation: BAB21772.1.
CCDSiCCDS2359.1. [Q70E73-10]
CCDS2360.1. [Q70E73-9]
RefSeqiNP_976241.1. NM_203365.3. [Q70E73-9]
NP_998754.1. NM_213589.2. [Q70E73-10]
UniGeneiHs.471162.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4GMVX-ray2.40A/B240-520[»]
4GN1X-ray2.40A/B/C/D266-520[»]
ProteinModelPortaliQ70E73.
SMRiQ70E73.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122380. 14 interactors.
DIPiDIP-61336N.
IntActiQ70E73. 8 interactors.
STRINGi9606.ENSP00000316543.

PTM databases

iPTMnetiQ70E73.
PhosphoSitePlusiQ70E73.

Polymorphism and mutation databases

BioMutaiRAPH1.
DMDMi215274220.

Proteomic databases

EPDiQ70E73.
PaxDbiQ70E73.
PeptideAtlasiQ70E73.
PRIDEiQ70E73.

Protocols and materials databases

DNASUi65059.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000308091; ENSP00000311293; ENSG00000173166. [Q70E73-9]
ENST00000319170; ENSP00000316543; ENSG00000173166. [Q70E73-10]
ENST00000418114; ENSP00000396711; ENSG00000173166. [Q70E73-2]
ENST00000419464; ENSP00000390578; ENSG00000173166. [Q70E73-5]
ENST00000423104; ENSP00000397751; ENSG00000173166. [Q70E73-7]
ENST00000439222; ENSP00000411138; ENSG00000173166. [Q70E73-8]
ENST00000453034; ENSP00000406662; ENSG00000173166. [Q70E73-6]
GeneIDi65059.
KEGGihsa:65059.
UCSCiuc002vad.5. human. [Q70E73-10]

Organism-specific databases

CTDi65059.
DisGeNETi65059.
GeneCardsiRAPH1.
HGNCiHGNC:14436. RAPH1.
HPAiHPA016744.
HPA020027.
MIMi609035. gene.
neXtProtiNX_Q70E73.
OpenTargetsiENSG00000173166.
PharmGKBiPA24749.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3751. Eukaryota.
ENOG410XXC8. LUCA.
GeneTreeiENSGT00550000074537.
HOGENOMiHOG000154072.
HOVERGENiHBG089219.
InParanoidiQ70E73.
PhylomeDBiQ70E73.
TreeFamiTF317511.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000173166-MONOMER.

Miscellaneous databases

ChiTaRSiRAPH1. human.
GeneWikiiRAPH1.
GenomeRNAii65059.
PROiQ70E73.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000173166.
CleanExiHS_RAPH1.
ExpressionAtlasiQ70E73. baseline and differential.
GenevisibleiQ70E73. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR000159. RA_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00788. RA. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00314. RA. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50200. RA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRAPH1_HUMAN
AccessioniPrimary (citable) accession number: Q70E73
Secondary accession number(s): Q96Q37, Q9C0I2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: November 25, 2008
Last modified: November 2, 2016
This is version 116 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.