Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kielin/chordin-like protein

Gene

KCP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways (By similarity).By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Kielin/chordin-like proteinCurated
Alternative name(s):
Cysteine-rich BMP regulator 2
Cysteine-rich motor neuron 2 protein
Short name:
CRIM-2
Kielin/chordin-like protein 1
Short name:
KCP-1
Gene namesi
Name:KCPImported
Synonyms:CRIM2, KCP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

EuPathDBiHostDB:ENSG00000135253.13
HGNCiHGNC:17585 KCP
MIMi609344 gene
neXtProtiNX_Q6ZWJ8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi375616
OpenTargetsiENSG00000135253
PharmGKBiPA164721151

Polymorphism and mutation databases

BioMutaiKCP
DMDMi218511989

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000031858624 – 1568Kielin/chordin-like proteinSequence analysisAdd BLAST1545

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi340N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi499N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1090N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1237 ↔ 1245PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ6ZWJ8
PeptideAtlasiQ6ZWJ8
PRIDEiQ6ZWJ8

PTM databases

iPTMnetiQ6ZWJ8
PhosphoSitePlusiQ6ZWJ8

Expressioni

Gene expression databases

BgeeiENSG00000135253
CleanExiHS_CRIM2

Interactioni

Subunit structurei

Interacts with BMP7 and, by doing so, enhances binding to the type I receptors that contains cytoplasmic serine/threonine protein kinase domains. Also able to interact with activin-A and TGFB1 (By similarity).By similarity

Structurei

3D structure databases

ProteinModelPortaliQ6ZWJ8
SMRiQ6ZWJ8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini136 – 193VWFC 1PROSITE-ProRule annotationAdd BLAST58
Domaini194 – 253VWFC 2PROSITE-ProRule annotationAdd BLAST60
Domaini253 – 312VWFC 3PROSITE-ProRule annotationAdd BLAST60
Domaini312 – 370VWFC 4PROSITE-ProRule annotationAdd BLAST59
Domaini426 – 485VWFC 5PROSITE-ProRule annotationAdd BLAST60
Domaini485 – 544VWFC 6PROSITE-ProRule annotationAdd BLAST60
Domaini544 – 602VWFC 7PROSITE-ProRule annotationAdd BLAST59
Domaini602 – 661VWFC 8PROSITE-ProRule annotationAdd BLAST60
Domaini667 – 725VWFC 9PROSITE-ProRule annotationAdd BLAST59
Domaini725 – 782VWFC 10PROSITE-ProRule annotationAdd BLAST58
Domaini782 – 841VWFC 11PROSITE-ProRule annotationAdd BLAST60
Domaini900 – 959VWFC 12PROSITE-ProRule annotationAdd BLAST60
Domaini959 – 1017VWFC 13PROSITE-ProRule annotationAdd BLAST59
Domaini1017 – 1085VWFC 14PROSITE-ProRule annotationAdd BLAST69
Domaini1082 – 1145VWFC 15PROSITE-ProRule annotationAdd BLAST64
Domaini1149 – 1209VWFC 16PROSITE-ProRule annotationAdd BLAST61
Domaini1214 – 1426VWFDPROSITE-ProRule annotationAdd BLAST213
Domaini1483 – 1543TILAdd BLAST61

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili60 – 87Sequence analysisAdd BLAST28

Keywords - Domaini

Coiled coil, Repeat, Signal

Phylogenomic databases

GeneTreeiENSGT00840000129763
InParanoidiQ6ZWJ8
PhylomeDBiQ6ZWJ8

Family and domain databases

InterProiView protein in InterPro
IPR036084 Ser_inhib-like_sf
IPR014853 Unchr_dom_Cys-rich
IPR001007 VWF_dom
IPR001846 VWF_type-D
PfamiView protein in Pfam
PF00093 VWC, 9 hits
PF00094 VWD, 1 hit
SMARTiView protein in SMART
SM00832 C8, 1 hit
SM00214 VWC, 19 hits
SM00215 VWC_out, 8 hits
SM00216 VWD, 1 hit
SUPFAMiSSF57567 SSF57567, 1 hit
PROSITEiView protein in PROSITE
PS01208 VWFC_1, 13 hits
PS50184 VWFC_2, 16 hits
PS51233 VWFD, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q6ZWJ8-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGVGAAALS LLLHLGALAL AAGAEGGAVP REPPGQQTTA HSSVLAGNSQ
60 70 80 90 100
EQWHPLREWL GRLEAAVMEL REQNKDLQTR VRQLESCECH PASPQCWGLG
110 120 130 140 150
RAWPEGARWE PDACTACVCQ DGAAHCGPQA HLPHCRGCSQ NGQTYGNGET
160 170 180 190 200
FSPDACTTCR CLTGAVQCQG PSCSELNCLE SCTPPGECCP ICRPGCDYEG
210 220 230 240 250
QLYEEGVTFL SSSNPCLQCT CLRSRVRCMA LKCPPSPCPE PVLRPGHCCP
260 270 280 290 300
TCQGCTEGGS HWEHGQEWTT PGDPCRICRC LEGHIQCRQR ECASLCPYPA
310 320 330 340 350
RPLPGTCCPV CDGCFLNGRE HRSGEPVGSG DPCSHCRCAN GSVQCEPLPC
360 370 380 390 400
PPVPCRHPGK IPGQCCPVCD GCEYQGHQYQ SQETFRLQER GLCVRCSCQA
410 420 430 440 450
GEVSCEEQEC PVTPCALPAS GRQLCPACEL DGEEFAEGVQ WEPDGRPCTA
460 470 480 490 500
CVCQDGVPKC GAVLCPPAPC QHPTQPPGAC CPSCDSCTYH SQVYANGQNF
510 520 530 540 550
TDADSPCHAC HCQDGTVTCS LVDCPPTTCA RPQSGPGQCC PRCPDCILEE
560 570 580 590 600
EVFVDGESFS HPRDPCQECR CQEGHAHCQP RPCPRAPCAH PLPGTCCPND
610 620 630 640 650
CSGCAFGGKE YPSGADFPHP SDPCRLCRCL SGNVQCLARR CVPLPCPEPV
660 670 680 690 700
LLPGECCPQC PAAPAPAGCP RPGAAHARHQ EYFSPPGDPC RRCLCLDGSV
710 720 730 740 750
SCQRLPCPPA PCAHPRQGPC CPSCDGCLYQ GKEFASGERF PSPTAACHLC
760 770 780 790 800
LCWEGSVSCE PKACAPALCP FPARGDCCPD CDGCEYLGES YLSNQEFPDP
810 820 830 840 850
REPCNLCTCL GGFVTCGRRP CEPPGCSHPL IPSGHCCPTC QGCRYHGVTT
860 870 880 890 900
ASGETLPDPL DPTCSLCTCQ EGSMRCQKKP CPPALCPHPS PGPCFCPVCH
910 920 930 940 950
SCLSQGREHQ DGEEFEGPAG SCEWCRCQAG QVSCVRLQCP PLPCKLQVTE
960 970 980 990 1000
RGSCCPRCRG CLAHGEEHPE GSRWVPPDSA CSSCVCHEGV VTCARIQCIS
1010 1020 1030 1040 1050
SCAQPRQGPH DCCPQCSDCE HEGRKYEPGE SFQPGADPCE VCICEPQPEG
1060 1070 1080 1090 1100
PPSLRCHRRQ CPSLVGCPPS QLLPPGPQHC CPTCAEALSN CSEGLLGSEL
1110 1120 1130 1140 1150
APPDPCYTCQ CQDLTWLCIH QACPELSCPL SERHTPPGSC CPVCRAPTQS
1160 1170 1180 1190 1200
CVHQGREVAS GERWTVDTCT SCSCMAGTVR CQSQRCSPLS CGPDKAPALS
1210 1220 1230 1240 1250
PGSCCPRCLP RPASCMAFGD PHYRTFDGRL LHFQGSCSYV LAKDCHSGDF
1260 1270 1280 1290 1300
SVHVTNDDRG RSGVAWTQEV AVLLGDMAVR LLQDGAVTVD GHPVALPFLQ
1310 1320 1330 1340 1350
EPLLYVELRG HTVILHAQPG LQVLWDGQSQ VEVSVPGSYQ GRTCGLCGNF
1360 1370 1380 1390 1400
NGFAQDDLQG PEGLLLPSEA AFGNSWQVSE GLWPGRPCSA GREVDPCRAA
1410 1420 1430 1440 1450
GYRARREANA RCGVLKSSPF SRCHAVVPPE PFFAACVYDL CACGPGSSAD
1460 1470 1480 1490 1500
ACLCDALEAY ASHCRQAGVT PTWRGPTLCV VGCPLERGFV FDECGPPCPR
1510 1520 1530 1540 1550
TCFNQHIPLG ELAAHCVRPC VPGCQCPAGL VEHEAHCIPP EACPQVLLTG
1560
DQPLGARPSP SREPQETP
Note: No experimental confirmation available. Derived from EST data.
Length:1,568
Mass (Da):166,935
Last modified:March 28, 2018 - v3
Checksum:i7C63B5766B3EA7F3
GO
Isoform 2 (identifier: Q6ZWJ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1174: Missing.
     1379-1468: SEGLWPGRPC...AYASHCRQAG → QEGRGYPPGL...LKASCDGSRL
     1469-1568: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:294
Mass (Da):31,744
Checksum:i12152D81A55C0925
GO
Isoform 4 (identifier: Q6ZWJ8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     163-193: TGAVQCQGPSCSELNCLESCTPPGECCPICR → EGTITCNQKPCPRGPCPEPGACCPHCK
     784-818: CEYLGESYLSNQEFPDPREPCNLCTCLGGFVTCGR → EGHGIGSCRGGMRETRGLGQNNLYCPRVDLKYLLQ
     819-1568: Missing.

Note: No experimental confirmation available.
Show »
Length:814
Mass (Da):86,623
Checksum:iE4AF99A652A76474
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti214N → K in BAC85504 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03878347G → E. Corresponds to variant dbSNP:rs7787221Ensembl.1
Natural variantiVAR_059625459K → E1 PublicationCorresponds to variant dbSNP:rs7782976Ensembl.1
Natural variantiVAR_059626688D → V1 PublicationCorresponds to variant dbSNP:rs3734971Ensembl.1
Natural variantiVAR_0596271193P → R. Corresponds to variant dbSNP:rs7786641Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0593521 – 1174Missing in isoform 2. Add BLAST1174
Alternative sequenceiVSP_059353163 – 193TGAVQ…CPICR → EGTITCNQKPCPRGPCPEPG ACCPHCK in isoform 4. Add BLAST31
Alternative sequenceiVSP_059354784 – 818CEYLG…VTCGR → EGHGIGSCRGGMRETRGLGQ NNLYCPRVDLKYLLQ in isoform 4. Add BLAST35
Alternative sequenceiVSP_059355819 – 1568Missing in isoform 4. Add BLAST750
Alternative sequenceiVSP_0593561379 – 1468SEGLW…CRQAG → QEGRGYPPGLELPPVLLQME WSRRAQEQLLWDLELLTGVE LGLFWPPQAQFFGPRGQAQQ AWSQCCQPGGSTGGDPEQPI LKASCDGSRL in isoform 2. Add BLAST90
Alternative sequenceiVSP_0593571469 – 1568Missing in isoform 2. Add BLAST100

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122706 mRNA Translation: BAC85504.1
AK090684 mRNA Translation: BAC03505.1
AC025594 Genomic DNA No translation available.
KF495713 Genomic DNA No translation available.
KF510975 Genomic DNA No translation available.
CH471070 Genomic DNA Translation: EAW83694.1
RefSeqiNP_955381.2, NM_199349.2
UniGeneiHs.371746

Genome annotation databases

EnsembliENST00000613019; ENSP00000477644; ENSG00000135253 [Q6ZWJ8-3]
GeneIDi375616
KEGGihsa:375616

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiKCP_HUMAN
AccessioniPrimary (citable) accession number: Q6ZWJ8
Secondary accession number(s): A0A087WT73, Q8NBE0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: March 28, 2018
Last modified: April 25, 2018
This is version 93 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health