Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

TOM1-like protein 2

Gene

TOM1L2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable role in protein transport. May regulate growth factor-induced mitogenic signaling.2 Publications

GO - Molecular functioni

  • clathrin binding Source: UniProtKB
  • protein kinase binding Source: UniProtKB

GO - Biological processi

  • intracellular protein transport Source: InterPro
  • negative regulation of mitotic nuclear division Source: UniProtKB
  • signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
TOM1-like protein 2
Alternative name(s):
Target of Myb-like protein 2
Gene namesi
Name:TOM1L2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:11984. TOM1L2.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • intracellular Source: InterPro
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi146691.
OpenTargetsiENSG00000175662.
PharmGKBiPA36668.

Polymorphism and mutation databases

BioMutaiTOM1L2.
DMDMi74712301.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002787901 – 507TOM1-like protein 2Add BLAST507

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei160PhosphoserineCombined sources1
Modified residuei164PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6ZVM7.
MaxQBiQ6ZVM7.
PaxDbiQ6ZVM7.
PeptideAtlasiQ6ZVM7.
PRIDEiQ6ZVM7.

PTM databases

iPTMnetiQ6ZVM7.
PhosphoSitePlusiQ6ZVM7.

Miscellaneous databases

PMAP-CutDBQ6ZVM7.

Expressioni

Tissue specificityi

Ubiquitously expressed with higher expression in heart and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000175662.
CleanExiHS_TOM1L2.
ExpressionAtlasiQ6ZVM7. baseline and differential.
GenevisibleiQ6ZVM7. HS.

Organism-specific databases

HPAiHPA022541.
HPA023304.

Interactioni

Subunit structurei

Interacts with clathrin, SRC and TOLLIP.2 Publications

GO - Molecular functioni

  • clathrin binding Source: UniProtKB
  • protein kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi127001. 28 interactors.
DIPiDIP-61860N.
IntActiQ6ZVM7. 6 interactors.
MINTiMINT-1180181.
STRINGi9606.ENSP00000368818.

Structurei

3D structure databases

ProteinModelPortaliQ6ZVM7.
SMRiQ6ZVM7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 152VHSPROSITE-ProRule annotationAdd BLAST133
Domaini219 – 307GATPROSITE-ProRule annotationAdd BLAST89

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi329 – 334Clathrin-binding6

Domaini

The GAT domain mediates interaction with TOLLIP.

Sequence similaritiesi

Belongs to the TOM1 family.Curated
Contains 1 GAT domain.PROSITE-ProRule annotation
Contains 1 VHS domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1087. Eukaryota.
ENOG410Y26G. LUCA.
GeneTreeiENSGT00860000133703.
HOGENOMiHOG000285970.
HOVERGENiHBG025068.
InParanoidiQ6ZVM7.
OMAiDPAANMH.
OrthoDBiEOG091G08M1.
PhylomeDBiQ6ZVM7.
TreeFamiTF314105.

Family and domain databases

Gene3Di1.20.58.160. 1 hit.
1.25.40.90. 1 hit.
InterProiIPR008942. ENTH_VHS.
IPR004152. GAT_dom.
IPR014645. TOM1.
IPR027429. TOM1L2.
IPR002014. VHS_dom.
[Graphical view]
PANTHERiPTHR13856:SF31. PTHR13856:SF31. 1 hit.
PfamiPF03127. GAT. 1 hit.
PF00790. VHS. 1 hit.
[Graphical view]
PIRSFiPIRSF036948. TOM1. 1 hit.
SMARTiSM00288. VHS. 1 hit.
[Graphical view]
SUPFAMiSSF48464. SSF48464. 1 hit.
PROSITEiPS50909. GAT. 1 hit.
PS50179. VHS. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZVM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEFLLGNPFS TPVGQCLEKA TDGSLQSEDW TLNMEICDII NETEEGPKDA
60 70 80 90 100
IRALKKRLNG NRNYREVMLA LTVLETCVKN CGHRFHILVA NRDFIDSVLV
110 120 130 140 150
KIISPKNNPP TIVQDKVLAL IQAWADAFRS SPDLTGVVHI YEELKRKGVE
160 170 180 190 200
FPMADLDALS PIHTPQRSVP EVDPAATMPR SQSQQRTSAG SYSSPPPAPY
210 220 230 240 250
SAPQAPALSV TGPITANSEQ IARLRSELDV VRGNTKVMSE MLTEMVPGQE
260 270 280 290 300
DSSDLELLQE LNRTCRAMQQ RIVELISRVS NEEVTEELLH VNDDLNNVFL
310 320 330 340 350
RYERFERYRS GRSVQNASNG VLNEVTEDNL IDLGPGSPAV VSPMVGNTAP
360 370 380 390 400
PSSLSSQLAG LDLGTESVSG TLSSLQQCNP RDGFDMFAQT RGNSLAEQRK
410 420 430 440 450
TVTYEDPQAV GGLASALDNR KQSSEGIPVA QPSVMDDIEV WLRTDLKGDD
460 470 480 490 500
LEEGVTSEEF DKFLEERAKA AEMVPDLPSP PMEAPAPASN PSGRKKPERS

EDALFAL
Length:507
Mass (Da):55,556
Last modified:July 5, 2004 - v1
Checksum:i6CB4B4433076D8D0
GO
Isoform 2 (identifier: Q6ZVM7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-122: Missing.

Note: No experimental confirmation available.
Show »
Length:457
Mass (Da):49,964
Checksum:i92D76584C342D6C8
GO
Isoform 3 (identifier: Q6ZVM7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-167: Missing.

Show »
Length:462
Mass (Da):50,509
Checksum:i0E8EE9521D76DAFB
GO
Isoform 4 (identifier: Q6ZVM7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-267: Missing.

Note: No experimental confirmation available.
Show »
Length:240
Mass (Da):26,136
Checksum:i82DE20A5B198F997
GO
Isoform 5 (identifier: Q6ZVM7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-220: Missing.
     426-426: G → GTFLSSAQKRGRGGESDLEPIDSWLITQGM

Note: No experimental confirmation available.
Show »
Length:483
Mass (Da):53,368
Checksum:i6C226EFFDDC0DF24
GO

Sequence cautioni

The sequence AAL78338 differs from that shown. Reason: Frameshift at positions 101, 121 and 170.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12P → A in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti177T → S in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti323N → S in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti331I → L in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti347N → S in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti400K → Q in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti466E → V in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti475P → H in AAL78338 (PubMed:11997338).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0233901 – 267Missing in isoform 4. 1 PublicationAdd BLAST267
Alternative sequenceiVSP_02339173 – 122Missing in isoform 2. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_023392123 – 167Missing in isoform 3. 2 PublicationsAdd BLAST45
Alternative sequenceiVSP_057214168 – 220Missing in isoform 5. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_057215426G → GTFLSSAQKRGRGGESDLEP IDSWLITQGM in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF467441 mRNA. Translation: AAL78338.1. Sequence problems.
AK057308 mRNA. Translation: BAB71421.1.
AK124331 mRNA. Translation: BAC85834.1.
AK294846 mRNA. Translation: BAH11903.1.
AK301944 mRNA. Translation: BAH13590.1.
AC087163 Genomic DNA. No translation available.
AC122129 Genomic DNA. No translation available.
KF456255 Genomic DNA. No translation available.
BC051650 mRNA. Translation: AAH51650.1.
CCDSiCCDS32584.1. [Q6ZVM7-2]
CCDS42270.1. [Q6ZVM7-1]
CCDS74002.1. [Q6ZVM7-3]
CCDS74003.1. [Q6ZVM7-5]
RefSeqiNP_001028723.1. NM_001033551.2. [Q6ZVM7-2]
NP_001076437.1. NM_001082968.1. [Q6ZVM7-1]
NP_001275715.1. NM_001288786.1. [Q6ZVM7-5]
NP_001275716.1. NM_001288787.1. [Q6ZVM7-3]
NP_001275717.1. NM_001288788.1.
NP_001275718.1. NM_001288789.1.
UniGeneiHs.462379.

Genome annotation databases

EnsembliENST00000318094; ENSP00000312860; ENSG00000175662. [Q6ZVM7-3]
ENST00000379504; ENSP00000368818; ENSG00000175662. [Q6ZVM7-1]
ENST00000395739; ENSP00000379088; ENSG00000175662. [Q6ZVM7-3]
ENST00000478943; ENSP00000463313; ENSG00000175662. [Q6ZVM7-4]
ENST00000535933; ENSP00000438621; ENSG00000175662. [Q6ZVM7-5]
ENST00000581396; ENSP00000464297; ENSG00000175662. [Q6ZVM7-2]
GeneIDi146691.
KEGGihsa:146691.
UCSCiuc002gry.5. human. [Q6ZVM7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF467441 mRNA. Translation: AAL78338.1. Sequence problems.
AK057308 mRNA. Translation: BAB71421.1.
AK124331 mRNA. Translation: BAC85834.1.
AK294846 mRNA. Translation: BAH11903.1.
AK301944 mRNA. Translation: BAH13590.1.
AC087163 Genomic DNA. No translation available.
AC122129 Genomic DNA. No translation available.
KF456255 Genomic DNA. No translation available.
BC051650 mRNA. Translation: AAH51650.1.
CCDSiCCDS32584.1. [Q6ZVM7-2]
CCDS42270.1. [Q6ZVM7-1]
CCDS74002.1. [Q6ZVM7-3]
CCDS74003.1. [Q6ZVM7-5]
RefSeqiNP_001028723.1. NM_001033551.2. [Q6ZVM7-2]
NP_001076437.1. NM_001082968.1. [Q6ZVM7-1]
NP_001275715.1. NM_001288786.1. [Q6ZVM7-5]
NP_001275716.1. NM_001288787.1. [Q6ZVM7-3]
NP_001275717.1. NM_001288788.1.
NP_001275718.1. NM_001288789.1.
UniGeneiHs.462379.

3D structure databases

ProteinModelPortaliQ6ZVM7.
SMRiQ6ZVM7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127001. 28 interactors.
DIPiDIP-61860N.
IntActiQ6ZVM7. 6 interactors.
MINTiMINT-1180181.
STRINGi9606.ENSP00000368818.

PTM databases

iPTMnetiQ6ZVM7.
PhosphoSitePlusiQ6ZVM7.

Polymorphism and mutation databases

BioMutaiTOM1L2.
DMDMi74712301.

Proteomic databases

EPDiQ6ZVM7.
MaxQBiQ6ZVM7.
PaxDbiQ6ZVM7.
PeptideAtlasiQ6ZVM7.
PRIDEiQ6ZVM7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318094; ENSP00000312860; ENSG00000175662. [Q6ZVM7-3]
ENST00000379504; ENSP00000368818; ENSG00000175662. [Q6ZVM7-1]
ENST00000395739; ENSP00000379088; ENSG00000175662. [Q6ZVM7-3]
ENST00000478943; ENSP00000463313; ENSG00000175662. [Q6ZVM7-4]
ENST00000535933; ENSP00000438621; ENSG00000175662. [Q6ZVM7-5]
ENST00000581396; ENSP00000464297; ENSG00000175662. [Q6ZVM7-2]
GeneIDi146691.
KEGGihsa:146691.
UCSCiuc002gry.5. human. [Q6ZVM7-1]

Organism-specific databases

CTDi146691.
DisGeNETi146691.
GeneCardsiTOM1L2.
HGNCiHGNC:11984. TOM1L2.
HPAiHPA022541.
HPA023304.
MIMi615519. gene.
neXtProtiNX_Q6ZVM7.
OpenTargetsiENSG00000175662.
PharmGKBiPA36668.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1087. Eukaryota.
ENOG410Y26G. LUCA.
GeneTreeiENSGT00860000133703.
HOGENOMiHOG000285970.
HOVERGENiHBG025068.
InParanoidiQ6ZVM7.
OMAiDPAANMH.
OrthoDBiEOG091G08M1.
PhylomeDBiQ6ZVM7.
TreeFamiTF314105.

Miscellaneous databases

ChiTaRSiTOM1L2. human.
GeneWikiiTOM1L2.
GenomeRNAii146691.
PMAP-CutDBQ6ZVM7.
PROiQ6ZVM7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000175662.
CleanExiHS_TOM1L2.
ExpressionAtlasiQ6ZVM7. baseline and differential.
GenevisibleiQ6ZVM7. HS.

Family and domain databases

Gene3Di1.20.58.160. 1 hit.
1.25.40.90. 1 hit.
InterProiIPR008942. ENTH_VHS.
IPR004152. GAT_dom.
IPR014645. TOM1.
IPR027429. TOM1L2.
IPR002014. VHS_dom.
[Graphical view]
PANTHERiPTHR13856:SF31. PTHR13856:SF31. 1 hit.
PfamiPF03127. GAT. 1 hit.
PF00790. VHS. 1 hit.
[Graphical view]
PIRSFiPIRSF036948. TOM1. 1 hit.
SMARTiSM00288. VHS. 1 hit.
[Graphical view]
SUPFAMiSSF48464. SSF48464. 1 hit.
PROSITEiPS50909. GAT. 1 hit.
PS50179. VHS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTM1L2_HUMAN
AccessioniPrimary (citable) accession number: Q6ZVM7
Secondary accession number(s): B7Z2L7
, B7Z7F4, Q86V61, Q8TDE7, Q96M88
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: July 5, 2004
Last modified: November 30, 2016
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.