Q6ZV70 (LANC3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 55.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LanC-like protein 3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 420 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Belongs to the LanC-like protein family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Molecular function | catalytic activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6ZV70-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6ZV70-2) The sequence of this isoform differs from the canonical sequence as follows: 368-420: RFAQFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPNQAEFPLFSVFV → SSFPVNLIKMEHLLYTRQHCF |
Sequence annotation (Features)
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK124915 mRNA. Translation: BAC85993.1. AL627244 Genomic DNA. No translation available. AL121577 Genomic DNA. No translation available. BC093667 mRNA. Translation: AAH93667.1. BC093669 mRNA. Translation: AAH93669.1. |
| IPI | IPI00394852. IPI00643639. |
| RefSeq | NP_001163802.1. NM_001170331.1. NP_940913.1. NM_198511.2. |
| UniGene | Hs.521932. |
3D structure databases | |
| ProteinModelPortal | Q6ZV70. |
| SMR | Q6ZV70. Positions 1-418. |
| ModBase | Search... |
Polymorphism databases | |
| DMDM | 146324960. |
Proteomic databases | |
| PRIDE | Q6ZV70. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000378619; ENSP00000367882; ENSG00000147036. |
| GeneID | 347404. |
| KEGG | hsa:347404. |
| UCSC | uc004ddp.1. human. |
Organism-specific databases | |
| CTD | 347404. |
| GeneCards | GC0XP037431. |
| HGNC | HGNC:24767. LANCL3. |
| HPA | HPA005470. |
| neXtProt | NX_Q6ZV70. |
| PharmGKB | PA134879796. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG15399. |
| GeneTree | ENSGT00530000063186. |
| HOGENOM | HBG715012. |
| HOVERGEN | HBG094983. |
| InParanoid | Q6ZV70. |
| OMA | ALGRPDY. |
| PhylomeDB | Q6ZV70. |
Gene expression databases | |
| ArrayExpress | Q6ZV70. |
| Bgee | Q6ZV70. |
| CleanEx | HS_LANCL3. |
| Genevestigator | Q6ZV70. |
Family and domain databases | |
| InterPro | IPR008928. 6-hairpin_glycosidase-like. IPR007822. LANC-like. IPR020464. LanC-like_prot_euk. [Graphical view] |
| Pfam | PF05147. LANC_like. 1 hit. [Graphical view] |
| PRINTS | PR01951. LANCEUKARYTE. PR01950. LANCSUPER. |
| SUPFAM | SSF48208. Glyco_trans_6hp. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 99128. |
Entry information
| Entry name | LANC3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6ZV70 Secondary accession number(s): A6NHE3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with