Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LanC-like protein 3

Gene

LANCL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
LanC-like protein 3
Gene namesi
Name:LANCL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:24767. LANCL3.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134879796.

Polymorphism and mutation databases

BioMutaiLANCL3.
DMDMi146324960.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 420420LanC-like protein 3PRO_0000285251Add
BLAST

Proteomic databases

MaxQBiQ6ZV70.
PaxDbiQ6ZV70.
PRIDEiQ6ZV70.

PTM databases

iPTMnetiQ6ZV70.
PhosphoSiteiQ6ZV70.

Expressioni

Gene expression databases

BgeeiQ6ZV70.
CleanExiHS_LANCL3.
GenevisibleiQ6ZV70. HS.

Organism-specific databases

HPAiHPA005470.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000367882.

Structurei

3D structure databases

ProteinModelPortaliQ6ZV70.
SMRiQ6ZV70. Positions 4-418.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the LanC-like protein family.Curated

Phylogenomic databases

eggNOGiKOG2787. Eukaryota.
ENOG410XQIA. LUCA.
GeneTreeiENSGT00530000063186.
HOGENOMiHOG000240926.
HOVERGENiHBG094983.
InParanoidiQ6ZV70.
OMAiGRPDYVQ.
OrthoDBiEOG7JQBN5.
PhylomeDBiQ6ZV70.
TreeFamiTF300068.

Family and domain databases

Gene3Di1.50.10.10. 1 hit.
InterProiIPR012341. 6hp_glycosidase.
IPR007822. LANC-like.
IPR020464. LanC-like_prot_euk.
[Graphical view]
PfamiPF05147. LANC_like. 1 hit.
[Graphical view]
PRINTSiPR01951. LANCEUKARYTE.
PR01950. LANCSUPER.
SMARTiSM01260. LANC_like. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZV70-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDTKRCFANR FDDYQGSLLA GQCEEAVAPL VTATIERILQ ELPPLGGGAE
60 70 80 90 100
ARGATAGASA CQGGLYGGVA GVAYMLYHVS QSPLFATARE RYLRSAKRLI
110 120 130 140 150
DACARAEEWG EPDADTRAAF LLGGAGVYAV ATLVYHALGR SDYVQPLGKF
160 170 180 190 200
RALCAVCAPV SFLECGSDEL FVGRAGYLCA ALVLKQKLAQ EVLTPAQIKS
210 220 230 240 250
ICQAILDSGK QYAIKKRKPF PLMYSYYGTE YLGAAHGLSS ILQMLLSYHE
260 270 280 290 300
HLKPSDRELV WQSVDFLMEQ EQNCNWPPEL GETIERENEL VHWCHGAPGI
310 320 330 340 350
AYLFAKAYLV SKKPQYLDTC IRCGELTWQK GLLKKGPGIC HGVAGSAYVF
360 370 380 390 400
LLLYRLTGNS KYIYRAQRFA QFLFTEEFKA GSRVLESIYS LYEGFSGTVC
410 420
FLIDLLQPNQ AEFPLFSVFV
Length:420
Mass (Da):46,319
Last modified:May 1, 2007 - v2
Checksum:iEB5A966DE8784468
GO
Isoform 2 (identifier: Q6ZV70-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     368-420: RFAQFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPNQAEFPLFSVFV → SSFPVNLIKMEHLLYTRQHCF

Show »
Length:388
Mass (Da):42,780
Checksum:iC341A77B6F63AFA6
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei368 – 42053RFAQF…FSVFV → SSFPVNLIKMEHLLYTRQHC F in isoform 2. 2 PublicationsVSP_024855Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK124915 mRNA. Translation: BAC85993.1.
AL627244 Genomic DNA. No translation available.
AL121577 Genomic DNA. No translation available.
BC093667 mRNA. Translation: AAH93667.1.
BC093669 mRNA. Translation: AAH93669.1.
CCDSiCCDS14240.1. [Q6ZV70-2]
CCDS55398.1. [Q6ZV70-1]
RefSeqiNP_001163802.1. NM_001170331.1. [Q6ZV70-1]
NP_940913.1. NM_198511.2. [Q6ZV70-2]
UniGeneiHs.521932.

Genome annotation databases

EnsembliENST00000378619; ENSP00000367882; ENSG00000147036. [Q6ZV70-1]
ENST00000378621; ENSP00000367885; ENSG00000147036. [Q6ZV70-2]
ENST00000614025; ENSP00000479231; ENSG00000147036. [Q6ZV70-2]
GeneIDi347404.
KEGGihsa:347404.
UCSCiuc004ddp.3. human. [Q6ZV70-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK124915 mRNA. Translation: BAC85993.1.
AL627244 Genomic DNA. No translation available.
AL121577 Genomic DNA. No translation available.
BC093667 mRNA. Translation: AAH93667.1.
BC093669 mRNA. Translation: AAH93669.1.
CCDSiCCDS14240.1. [Q6ZV70-2]
CCDS55398.1. [Q6ZV70-1]
RefSeqiNP_001163802.1. NM_001170331.1. [Q6ZV70-1]
NP_940913.1. NM_198511.2. [Q6ZV70-2]
UniGeneiHs.521932.

3D structure databases

ProteinModelPortaliQ6ZV70.
SMRiQ6ZV70. Positions 4-418.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000367882.

PTM databases

iPTMnetiQ6ZV70.
PhosphoSiteiQ6ZV70.

Polymorphism and mutation databases

BioMutaiLANCL3.
DMDMi146324960.

Proteomic databases

MaxQBiQ6ZV70.
PaxDbiQ6ZV70.
PRIDEiQ6ZV70.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000378619; ENSP00000367882; ENSG00000147036. [Q6ZV70-1]
ENST00000378621; ENSP00000367885; ENSG00000147036. [Q6ZV70-2]
ENST00000614025; ENSP00000479231; ENSG00000147036. [Q6ZV70-2]
GeneIDi347404.
KEGGihsa:347404.
UCSCiuc004ddp.3. human. [Q6ZV70-1]

Organism-specific databases

CTDi347404.
GeneCardsiLANCL3.
HGNCiHGNC:24767. LANCL3.
HPAiHPA005470.
neXtProtiNX_Q6ZV70.
PharmGKBiPA134879796.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2787. Eukaryota.
ENOG410XQIA. LUCA.
GeneTreeiENSGT00530000063186.
HOGENOMiHOG000240926.
HOVERGENiHBG094983.
InParanoidiQ6ZV70.
OMAiGRPDYVQ.
OrthoDBiEOG7JQBN5.
PhylomeDBiQ6ZV70.
TreeFamiTF300068.

Miscellaneous databases

GenomeRNAii347404.
PROiQ6ZV70.

Gene expression databases

BgeeiQ6ZV70.
CleanExiHS_LANCL3.
GenevisibleiQ6ZV70. HS.

Family and domain databases

Gene3Di1.50.10.10. 1 hit.
InterProiIPR012341. 6hp_glycosidase.
IPR007822. LANC-like.
IPR020464. LanC-like_prot_euk.
[Graphical view]
PfamiPF05147. LANC_like. 1 hit.
[Graphical view]
PRINTSiPR01951. LANCEUKARYTE.
PR01950. LANCSUPER.
SMARTiSM01260. LANC_like. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Substantia nigra.
  2. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Heart and Lung.

Entry informationi

Entry nameiLANC3_HUMAN
AccessioniPrimary (citable) accession number: Q6ZV70
Secondary accession number(s): A6NHE3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 1, 2007
Last modified: June 8, 2016
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.