Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6ZV29

- PLPL7_HUMAN

UniProt

Q6ZV29 - PLPL7_HUMAN

Protein

Patatin-like phospholipase domain-containing protein 7

Gene

PNPLA7

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 95 (01 Oct 2014)
      Sequence version 3 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Serine hydrolase, whose specific chemical modification by certain organophosphorus (OP) compounds leads to distal axonopathy.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei961 – 9611By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi145 – 272128cNMP 1Add
    BLAST
    Nucleotide bindingi458 – 580123cNMP 2Add
    BLAST
    Nucleotide bindingi576 – 696121cNMP 3Add
    BLAST

    GO - Molecular functioni

    1. hydrolase activity Source: UniProtKB-KW

    GO - Biological processi

    1. lipid metabolic process Source: InterPro

    Keywords - Molecular functioni

    Hydrolase

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Patatin-like phospholipase domain-containing protein 7 (EC:3.1.1.-)
    Gene namesi
    Name:PNPLA7
    Synonyms:C9orf111
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:24768. PNPLA7.

    Subcellular locationi

    Membrane Curated; Single-pass membrane protein Curated. Nucleus membrane By similarity; Single-pass membrane protein By similarity. Mitochondrion membrane By similarity; Single-pass membrane protein By similarity. Lysosome membrane By similarity; Single-pass membrane protein By similarity. Microsome membrane By similarity; Single-pass membrane protein By similarity
    Note: Found in the nuclear, mitochondrial, lysosomal, and microsomal fractions.By similarity

    GO - Cellular componenti

    1. endoplasmic reticulum Source: UniProtKB-KW
    2. integral component of membrane Source: UniProtKB-KW
    3. lysosomal membrane Source: UniProtKB-SubCell
    4. mitochondrial membrane Source: UniProtKB-SubCell
    5. nuclear membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Endoplasmic reticulum, Lysosome, Membrane, Microsome, Mitochondrion, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134935962.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 13171317Patatin-like phospholipase domain-containing protein 7PRO_0000293489Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi728 – 7281N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi975 – 9751N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1014 – 10141N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1233 – 12331N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ6ZV29.
    PaxDbiQ6ZV29.
    PRIDEiQ6ZV29.

    PTM databases

    PhosphoSiteiQ6ZV29.

    Expressioni

    Gene expression databases

    ArrayExpressiQ6ZV29.
    BgeeiQ6ZV29.
    GenevestigatoriQ6ZV29.

    Organism-specific databases

    HPAiHPA009130.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6ZV29.
    SMRiQ6ZV29. Positions 410-661.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei13 – 3321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini928 – 1094167PatatinAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi959 – 9635GXSXG

    Sequence similaritiesi

    Belongs to the NTE family.Curated
    Contains 3 cyclic nucleotide-binding domains.PROSITE-ProRule annotation
    Contains 1 patatin domain.Curated

    Keywords - Domaini

    Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0664.
    HOVERGENiHBG053067.
    InParanoidiQ6ZV29.
    KOiK14676.
    OMAiMACDRAR.
    PhylomeDBiQ6ZV29.
    TreeFamiTF300519.

    Family and domain databases

    Gene3Di2.60.120.10. 3 hits.
    InterProiIPR016035. Acyl_Trfase/lysoPLipase.
    IPR018490. cNMP-bd-like.
    IPR000595. cNMP-bd_dom.
    IPR002641. Patatin/PLipase_A2-rel.
    IPR014710. RmlC-like_jellyroll.
    [Graphical view]
    PfamiPF00027. cNMP_binding. 3 hits.
    PF01734. Patatin. 1 hit.
    [Graphical view]
    SMARTiSM00100. cNMP. 3 hits.
    [Graphical view]
    SUPFAMiSSF51206. SSF51206. 3 hits.
    SSF52151. SSF52151. 1 hit.
    PROSITEiPS50042. CNMP_BINDING_3. 3 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6ZV29-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEEEKDDSPQ LTGIAVGALL ALALVGVLIL FMFRRLRQFR QAQPTPQYRF     50
    RKRDKVMFYG RKIMRKVTTL PNTLVENTAL PRQRARKRTK VLSLAKRILR 100
    FKKEYPALQP KEPPPSLLEA DLTEFDVKNS HLPSEVLYML KNVRVLGHFE 150
    KPLFLELCKH IVFVQLQEGE HVFQPREPDP SICVVQDGRL EVCIQDTDGT 200
    EVVVKEVLAG DSVHSLLSIL DIITGHAAPY KTVSVRAAIP STILRLPAAA 250
    FHGVFEKYPE TLVRVVQIIM VRLQRVTFLA LHNYLGLTTE LFNAESQAIP 300
    LVSVASVAAG KAKKQVFYGE EERLKKPPRL QESCDSDHGG GRPAAAGPLL 350
    KRSHSVPAPS IRKQILEELE KPGAGDPDPS APQGGPGSAT SDLGMACDRA 400
    RVFLHSDEHP GSSVASKSRK SVMVAEIPST VSQHSESHTD ETLASRKSDA 450
    IFRAAKKDLL TLMKLEDSSL LDGRVALLHV PAGTVVSRQG DQDASILFVV 500
    SGLLHVYQRK IGSQEDTCLF LTRPGEMVGQ LAVLTGEPLI FTVKANRDCS 550
    FLSISKAHFY EIMRKQPTVV LGVAHTVVKR MSSFVRQIDF ALDWVEVEAG 600
    RAIYRQGDKS DCTYIMLSGR LRSVIRKDDG KKRLAGEYGR GDLVGVVETL 650
    THQARATTVH AVRDSELAKL PAGALTSIKR RYPQVVTRLI HLLGEKILGS 700
    LQQGPVTGHQ LGLPTEGSKW DLGNPAVNLS TVAVMPVSEE VPLTAFALEL 750
    EHALSAIGPT LLLTSDNIKR RLGSAALDSV HEYRLSSWLG QQEDTHRIVL 800
    YQVDGTLTPW TQRCVRQADC ILIVGLGDQE PTVGELERML ESTAVRAQKQ 850
    LILLHREEGP APARTVEWLN MRSWCSGHLH LCCPRRVFSR RSLPKLVEMY 900
    KHVFQRPPDR HSDFSRLARV LTGNAIALVL GGGGARGCAQ VGVLKALAEC 950
    GIPVDMVGGT SIGAFVGALY SEERNYSQMR IRAKQWAEGM TSLMKAALDL 1000
    TYPITSMFSG AGFNSSIFSV FKDQQIEDLW IPYFAITTDI TASAMRVHTD 1050
    GSLWWYVRAS MSLSGYMPPL CDPKDGHLLM DGGYINNLPA DVARSMGAKV 1100
    VIAIDVGSRD ETDLTNYGDA LSGWWLLWKR WNPLATKVKV LNMAEIQTRL 1150
    AYVCCVRQLE VVKSSDYCEY LRPPIDSYST LDFGKFNEIC EVGYQHGRTV 1200
    FDIWGRSGVL EKMLRDQQGP SKKPASAVLT CPNASFTDLA EIVSRIEPAK 1250
    PAMVDDESDY QTEYEEELLD VPRDAYADFQ STSAQQGSDL EDESSLRHRH 1300
    PSLAFPKLSE GSSDQDG 1317
    Length:1,317
    Mass (Da):145,733
    Last modified:May 18, 2010 - v3
    Checksum:i3C0DF9776006F349
    GO
    Isoform 2 (identifier: Q6ZV29-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         10-10: Q → QADFCLGTALHSWGLWFTEEGSPSTM
         384-433: GGPGSATSDL...VAEIPSTVSQ → ARVLCLLPQC...GHKPHVTVDT
         434-1317: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:458
    Mass (Da):50,719
    Checksum:i125B513AF8FA5CAC
    GO
    Isoform 3 (identifier: Q6ZV29-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1191-1255: EVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKPASAVLTCPNASFTDLAEIVSRIEPAKPAMVD → VP

    Note: No experimental confirmation available.

    Show »
    Length:1,254
    Mass (Da):138,848
    Checksum:i2A60F69C46051181
    GO
    Isoform 4 (identifier: Q6ZV29-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1256-1268: DESDYQTEYEEEL → GEWRRKTKPWRRA
         1269-1317: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,268
    Mass (Da):140,480
    Checksum:i1E4158DB3AC3BD63
    GO
    Isoform 5 (identifier: Q6ZV29-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         10-10: Q → QADFCLGTALHSWGLWFTEEGSPSTM

    Note: No experimental confirmation available.

    Show »
    Length:1,342
    Mass (Da):148,459
    Checksum:iE56D9FD160C30BC1
    GO

    Sequence cautioni

    The sequence BAB71033.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAI14579.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti173 – 1731F → L in BAC86509. (PubMed:14702039)Curated
    Sequence conflicti326 – 3261K → M in BAC86036. (PubMed:14702039)Curated
    Sequence conflicti384 – 39916Missing in BAC86509. (PubMed:14702039)CuratedAdd
    BLAST
    Sequence conflicti403 – 47371FLHSD…SLLDG → LCLLPQCLGGLPPTDTSVYS SASSDCCGCSMPVLCIMGHK PHVTVDT in BAC86509. (PubMed:14702039)CuratedAdd
    BLAST
    Sequence conflicti409 – 4091H → D in BAC86036. (PubMed:14702039)Curated
    Sequence conflicti874 – 8741W → S in BAB71033. (PubMed:14702039)Curated
    Sequence conflicti892 – 8965SLPKL → RLLPQ in BAC56931. (PubMed:14702039)Curated
    Sequence conflicti1016 – 102712SIFSV…DQQIE → WERAHLSPVRPQ in BAB15733. (PubMed:14702039)CuratedAdd
    BLAST
    Sequence conflicti1027 – 10271E → EQ in CAH56483. (PubMed:17974005)Curated
    Sequence conflicti1055 – 10551W → R in BAB15733. (PubMed:14702039)Curated
    Sequence conflicti1055 – 10551W → R in BAB71033. (PubMed:14702039)Curated
    Sequence conflicti1055 – 10551W → R in BAC56931. (PubMed:14702039)Curated
    Sequence conflicti1055 – 10551W → R in BAC86036. (PubMed:14702039)Curated
    Sequence conflicti1055 – 10551W → R in AAH25663. (PubMed:15489334)Curated
    Sequence conflicti1055 – 10551W → R in CAH56322. (PubMed:17974005)Curated
    Sequence conflicti1055 – 10551W → R in CAH56483. (PubMed:17974005)Curated
    Sequence conflicti1140 – 11401V → VV in CAH56483. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti236 – 2361R → H.
    Corresponds to variant rs12788 [ dbSNP | Ensembl ].
    VAR_061139
    Natural varianti286 – 2861G → S.
    Corresponds to variant rs2298171 [ dbSNP | Ensembl ].
    VAR_055696
    Natural varianti323 – 3231R → Q.
    Corresponds to variant rs11137410 [ dbSNP | Ensembl ].
    VAR_033060
    Natural varianti364 – 3641Q → E.
    Corresponds to variant rs3750378 [ dbSNP | Ensembl ].
    VAR_033061
    Natural varianti368 – 3681E → D.
    Corresponds to variant rs3750379 [ dbSNP | Ensembl ].
    VAR_033062
    Natural varianti387 – 3871G → S.
    Corresponds to variant rs11791683 [ dbSNP | Ensembl ].
    VAR_060409
    Natural varianti803 – 8031V → A.3 Publications
    Corresponds to variant rs1891630 [ dbSNP | Ensembl ].
    VAR_033063
    Natural varianti824 – 8241V → M.
    Corresponds to variant rs34938599 [ dbSNP | Ensembl ].
    VAR_033064
    Natural varianti908 – 9081P → L.1 Publication
    Corresponds to variant rs3812499 [ dbSNP | Ensembl ].
    VAR_033065
    Natural varianti993 – 9931L → M.
    Corresponds to variant rs35177111 [ dbSNP | Ensembl ].
    VAR_033066
    Natural varianti1050 – 10501D → N.1 Publication
    Corresponds to variant rs4962237 [ dbSNP | Ensembl ].
    VAR_055697

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei10 – 101Q → QADFCLGTALHSWGLWFTEE GSPSTM in isoform 2 and isoform 5. 1 PublicationVSP_026500
    Alternative sequencei384 – 43350GGPGS…STVSQ → ARVLCLLPQCLGGLPPTDTS VYSSASSDCCGCSMPVLCIM GHKPHVTVDT in isoform 2. 1 PublicationVSP_026501Add
    BLAST
    Alternative sequencei434 – 1317884Missing in isoform 2. 1 PublicationVSP_026502Add
    BLAST
    Alternative sequencei1191 – 125565EVGYQ…PAMVD → VP in isoform 3. 1 PublicationVSP_026503Add
    BLAST
    Alternative sequencei1256 – 126813DESDY…YEEEL → GEWRRKTKPWRRA in isoform 4. 1 PublicationVSP_026504Add
    BLAST
    Alternative sequencei1269 – 131749Missing in isoform 4. 1 PublicationVSP_026505Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024443 mRNA. Translation: BAB15733.1.
    AK055880 mRNA. Translation: BAB71033.1. Different initiation.
    AK122590 mRNA. Translation: BAC56931.1.
    AK125060 mRNA. Translation: BAC86036.1.
    AK126267 mRNA. Translation: BAC86509.1.
    AL365502 Genomic DNA. Translation: CAI14579.1. Sequence problems.
    BC025663 mRNA. Translation: AAH25663.1.
    AL832944 mRNA. Translation: CAH56322.1.
    AL832856 mRNA. Translation: CAH56483.1.
    CCDSiCCDS48070.1. [Q6ZV29-5]
    CCDS7045.1. [Q6ZV29-1]
    RefSeqiNP_001092007.2. NM_001098537.2.
    NP_689499.4. NM_152286.4.
    UniGeneiHs.294147.

    Genome annotation databases

    EnsembliENST00000277531; ENSP00000277531; ENSG00000130653. [Q6ZV29-1]
    ENST00000406427; ENSP00000384610; ENSG00000130653. [Q6ZV29-5]
    GeneIDi375775.
    KEGGihsa:375775.
    UCSCiuc004cnf.2. human. [Q6ZV29-1]
    uc010ncj.1. human. [Q6ZV29-5]

    Polymorphism databases

    DMDMi296452996.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024443 mRNA. Translation: BAB15733.1 .
    AK055880 mRNA. Translation: BAB71033.1 . Different initiation.
    AK122590 mRNA. Translation: BAC56931.1 .
    AK125060 mRNA. Translation: BAC86036.1 .
    AK126267 mRNA. Translation: BAC86509.1 .
    AL365502 Genomic DNA. Translation: CAI14579.1 . Sequence problems.
    BC025663 mRNA. Translation: AAH25663.1 .
    AL832944 mRNA. Translation: CAH56322.1 .
    AL832856 mRNA. Translation: CAH56483.1 .
    CCDSi CCDS48070.1. [Q6ZV29-5 ]
    CCDS7045.1. [Q6ZV29-1 ]
    RefSeqi NP_001092007.2. NM_001098537.2.
    NP_689499.4. NM_152286.4.
    UniGenei Hs.294147.

    3D structure databases

    ProteinModelPortali Q6ZV29.
    SMRi Q6ZV29. Positions 410-661.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q6ZV29.

    Polymorphism databases

    DMDMi 296452996.

    Proteomic databases

    MaxQBi Q6ZV29.
    PaxDbi Q6ZV29.
    PRIDEi Q6ZV29.

    Protocols and materials databases

    DNASUi 375775.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000277531 ; ENSP00000277531 ; ENSG00000130653 . [Q6ZV29-1 ]
    ENST00000406427 ; ENSP00000384610 ; ENSG00000130653 . [Q6ZV29-5 ]
    GeneIDi 375775.
    KEGGi hsa:375775.
    UCSCi uc004cnf.2. human. [Q6ZV29-1 ]
    uc010ncj.1. human. [Q6ZV29-5 ]

    Organism-specific databases

    GeneCardsi GC09M140354.
    H-InvDB HIX0201358.
    HGNCi HGNC:24768. PNPLA7.
    HPAi HPA009130.
    MIMi 612122. gene.
    neXtProti NX_Q6ZV29.
    PharmGKBi PA134935962.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0664.
    HOVERGENi HBG053067.
    InParanoidi Q6ZV29.
    KOi K14676.
    OMAi MACDRAR.
    PhylomeDBi Q6ZV29.
    TreeFami TF300519.

    Miscellaneous databases

    ChiTaRSi PNPLA7. human.
    GenomeRNAii 375775.
    NextBioi 100611.
    PROi Q6ZV29.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6ZV29.
    Bgeei Q6ZV29.
    Genevestigatori Q6ZV29.

    Family and domain databases

    Gene3Di 2.60.120.10. 3 hits.
    InterProi IPR016035. Acyl_Trfase/lysoPLipase.
    IPR018490. cNMP-bd-like.
    IPR000595. cNMP-bd_dom.
    IPR002641. Patatin/PLipase_A2-rel.
    IPR014710. RmlC-like_jellyroll.
    [Graphical view ]
    Pfami PF00027. cNMP_binding. 3 hits.
    PF01734. Patatin. 1 hit.
    [Graphical view ]
    SMARTi SM00100. cNMP. 3 hits.
    [Graphical view ]
    SUPFAMi SSF51206. SSF51206. 3 hits.
    SSF52151. SSF52151. 1 hit.
    PROSITEi PS50042. CNMP_BINDING_3. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1016-1268 (ISOFORM 4), VARIANTS ALA-803 AND ASN-1050.
      Tissue: Liver, Spleen, Thalamus and Trachea.
    2. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 688-1317 (ISOFORM 1), VARIANTS ALA-803 AND LEU-908.
      Tissue: Brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 721-1317 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 897-1317 (ISOFORM 3), VARIANT ALA-803.
      Tissue: Lymph node and Stomach.

    Entry informationi

    Entry nameiPLPL7_HUMAN
    AccessioniPrimary (citable) accession number: Q6ZV29
    Secondary accession number(s): B5MDD3
    , Q5T364, Q658X0, Q658Y3, Q6ZTS1, Q86YU8, Q8TAY5, Q96N75, Q9H7N5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 10, 2007
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 95 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3