SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6ZV29

- PLPL7_HUMAN

UniProt

Q6ZV29 - PLPL7_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Patatin-like phospholipase domain-containing protein 7
Gene
PNPLA7, C9orf111
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Serine hydrolase, whose specific chemical modification by certain organophosphorus (OP) compounds leads to distal axonopathy By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei961 – 9611 By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi145 – 272128cNMP 1
Add
BLAST
Nucleotide bindingi458 – 580123cNMP 2
Add
BLAST
Nucleotide bindingi576 – 696121cNMP 3
Add
BLAST

GO - Molecular functioni

  1. hydrolase activity Source: UniProtKB-KW

GO - Biological processi

  1. lipid metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Names & Taxonomyi

Protein namesi
Recommended name:
Patatin-like phospholipase domain-containing protein 7 (EC:3.1.1.-)
Gene namesi
Name:PNPLA7
Synonyms:C9orf111
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:24768. PNPLA7.

Subcellular locationi

Membrane; Single-pass membrane protein Reviewed prediction. Nucleus membrane; Single-pass membrane protein By similarity. Mitochondrion membrane; Single-pass membrane protein By similarity. Lysosome membrane; Single-pass membrane protein By similarity. Microsome membrane; Single-pass membrane protein By similarity
Note: Found in the nuclear, mitochondrial, lysosomal, and microsomal fractions By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei13 – 3321Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-KW
  2. integral component of membrane Source: UniProtKB-KW
  3. lysosomal membrane Source: UniProtKB-SubCell
  4. mitochondrial membrane Source: UniProtKB-SubCell
  5. nuclear membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Lysosome, Membrane, Microsome, Mitochondrion, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134935962.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13171317Patatin-like phospholipase domain-containing protein 7
PRO_0000293489Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi728 – 7281N-linked (GlcNAc...) Reviewed prediction
Glycosylationi975 – 9751N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1014 – 10141N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1233 – 12331N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ6ZV29.
PaxDbiQ6ZV29.
PRIDEiQ6ZV29.

PTM databases

PhosphoSiteiQ6ZV29.

Expressioni

Gene expression databases

ArrayExpressiQ6ZV29.
BgeeiQ6ZV29.
GenevestigatoriQ6ZV29.

Organism-specific databases

HPAiHPA009130.

Structurei

3D structure databases

ProteinModelPortaliQ6ZV29.
SMRiQ6ZV29. Positions 410-661.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini928 – 1094167Patatin
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi959 – 9635GXSXG

Sequence similaritiesi

Belongs to the NTE family.
Contains 1 patatin domain.

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0664.
HOVERGENiHBG053067.
InParanoidiQ6ZV29.
KOiK14676.
OMAiMACDRAR.
PhylomeDBiQ6ZV29.
TreeFamiTF300519.

Family and domain databases

Gene3Di2.60.120.10. 3 hits.
InterProiIPR016035. Acyl_Trfase/lysoPLipase.
IPR018490. cNMP-bd-like.
IPR000595. cNMP-bd_dom.
IPR002641. Patatin/PLipase_A2-rel.
IPR014710. RmlC-like_jellyroll.
[Graphical view]
PfamiPF00027. cNMP_binding. 3 hits.
PF01734. Patatin. 1 hit.
[Graphical view]
SMARTiSM00100. cNMP. 3 hits.
[Graphical view]
SUPFAMiSSF51206. SSF51206. 3 hits.
SSF52151. SSF52151. 1 hit.
PROSITEiPS50042. CNMP_BINDING_3. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6ZV29-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEEEKDDSPQ LTGIAVGALL ALALVGVLIL FMFRRLRQFR QAQPTPQYRF     50
RKRDKVMFYG RKIMRKVTTL PNTLVENTAL PRQRARKRTK VLSLAKRILR 100
FKKEYPALQP KEPPPSLLEA DLTEFDVKNS HLPSEVLYML KNVRVLGHFE 150
KPLFLELCKH IVFVQLQEGE HVFQPREPDP SICVVQDGRL EVCIQDTDGT 200
EVVVKEVLAG DSVHSLLSIL DIITGHAAPY KTVSVRAAIP STILRLPAAA 250
FHGVFEKYPE TLVRVVQIIM VRLQRVTFLA LHNYLGLTTE LFNAESQAIP 300
LVSVASVAAG KAKKQVFYGE EERLKKPPRL QESCDSDHGG GRPAAAGPLL 350
KRSHSVPAPS IRKQILEELE KPGAGDPDPS APQGGPGSAT SDLGMACDRA 400
RVFLHSDEHP GSSVASKSRK SVMVAEIPST VSQHSESHTD ETLASRKSDA 450
IFRAAKKDLL TLMKLEDSSL LDGRVALLHV PAGTVVSRQG DQDASILFVV 500
SGLLHVYQRK IGSQEDTCLF LTRPGEMVGQ LAVLTGEPLI FTVKANRDCS 550
FLSISKAHFY EIMRKQPTVV LGVAHTVVKR MSSFVRQIDF ALDWVEVEAG 600
RAIYRQGDKS DCTYIMLSGR LRSVIRKDDG KKRLAGEYGR GDLVGVVETL 650
THQARATTVH AVRDSELAKL PAGALTSIKR RYPQVVTRLI HLLGEKILGS 700
LQQGPVTGHQ LGLPTEGSKW DLGNPAVNLS TVAVMPVSEE VPLTAFALEL 750
EHALSAIGPT LLLTSDNIKR RLGSAALDSV HEYRLSSWLG QQEDTHRIVL 800
YQVDGTLTPW TQRCVRQADC ILIVGLGDQE PTVGELERML ESTAVRAQKQ 850
LILLHREEGP APARTVEWLN MRSWCSGHLH LCCPRRVFSR RSLPKLVEMY 900
KHVFQRPPDR HSDFSRLARV LTGNAIALVL GGGGARGCAQ VGVLKALAEC 950
GIPVDMVGGT SIGAFVGALY SEERNYSQMR IRAKQWAEGM TSLMKAALDL 1000
TYPITSMFSG AGFNSSIFSV FKDQQIEDLW IPYFAITTDI TASAMRVHTD 1050
GSLWWYVRAS MSLSGYMPPL CDPKDGHLLM DGGYINNLPA DVARSMGAKV 1100
VIAIDVGSRD ETDLTNYGDA LSGWWLLWKR WNPLATKVKV LNMAEIQTRL 1150
AYVCCVRQLE VVKSSDYCEY LRPPIDSYST LDFGKFNEIC EVGYQHGRTV 1200
FDIWGRSGVL EKMLRDQQGP SKKPASAVLT CPNASFTDLA EIVSRIEPAK 1250
PAMVDDESDY QTEYEEELLD VPRDAYADFQ STSAQQGSDL EDESSLRHRH 1300
PSLAFPKLSE GSSDQDG 1317
Length:1,317
Mass (Da):145,733
Last modified:May 18, 2010 - v3
Checksum:i3C0DF9776006F349
GO
Isoform 2 (identifier: Q6ZV29-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-10: Q → QADFCLGTALHSWGLWFTEEGSPSTM
     384-433: GGPGSATSDL...VAEIPSTVSQ → ARVLCLLPQC...GHKPHVTVDT
     434-1317: Missing.

Note: No experimental confirmation available.

Show »
Length:458
Mass (Da):50,719
Checksum:i125B513AF8FA5CAC
GO
Isoform 3 (identifier: Q6ZV29-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1191-1255: EVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKPASAVLTCPNASFTDLAEIVSRIEPAKPAMVD → VP

Note: No experimental confirmation available.

Show »
Length:1,254
Mass (Da):138,848
Checksum:i2A60F69C46051181
GO
Isoform 4 (identifier: Q6ZV29-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1256-1268: DESDYQTEYEEEL → GEWRRKTKPWRRA
     1269-1317: Missing.

Note: No experimental confirmation available.

Show »
Length:1,268
Mass (Da):140,480
Checksum:i1E4158DB3AC3BD63
GO
Isoform 5 (identifier: Q6ZV29-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-10: Q → QADFCLGTALHSWGLWFTEEGSPSTM

Note: No experimental confirmation available.

Show »
Length:1,342
Mass (Da):148,459
Checksum:iE56D9FD160C30BC1
GO

Sequence cautioni

The sequence BAB71033.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAI14579.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti236 – 2361R → H.
Corresponds to variant rs12788 [ dbSNP | Ensembl ].
VAR_061139
Natural varianti286 – 2861G → S.
Corresponds to variant rs2298171 [ dbSNP | Ensembl ].
VAR_055696
Natural varianti323 – 3231R → Q.
Corresponds to variant rs11137410 [ dbSNP | Ensembl ].
VAR_033060
Natural varianti364 – 3641Q → E.
Corresponds to variant rs3750378 [ dbSNP | Ensembl ].
VAR_033061
Natural varianti368 – 3681E → D.
Corresponds to variant rs3750379 [ dbSNP | Ensembl ].
VAR_033062
Natural varianti387 – 3871G → S.
Corresponds to variant rs11791683 [ dbSNP | Ensembl ].
VAR_060409
Natural varianti803 – 8031V → A.3 Publications
Corresponds to variant rs1891630 [ dbSNP | Ensembl ].
VAR_033063
Natural varianti824 – 8241V → M.
Corresponds to variant rs34938599 [ dbSNP | Ensembl ].
VAR_033064
Natural varianti908 – 9081P → L.1 Publication
Corresponds to variant rs3812499 [ dbSNP | Ensembl ].
VAR_033065
Natural varianti993 – 9931L → M.
Corresponds to variant rs35177111 [ dbSNP | Ensembl ].
VAR_033066
Natural varianti1050 – 10501D → N.1 Publication
Corresponds to variant rs4962237 [ dbSNP | Ensembl ].
VAR_055697

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei10 – 101Q → QADFCLGTALHSWGLWFTEE GSPSTM in isoform 2 and isoform 5.
VSP_026500
Alternative sequencei384 – 43350GGPGS…STVSQ → ARVLCLLPQCLGGLPPTDTS VYSSASSDCCGCSMPVLCIM GHKPHVTVDT in isoform 2.
VSP_026501Add
BLAST
Alternative sequencei434 – 1317884Missing in isoform 2.
VSP_026502Add
BLAST
Alternative sequencei1191 – 125565EVGYQ…PAMVD → VP in isoform 3.
VSP_026503Add
BLAST
Alternative sequencei1256 – 126813DESDY…YEEEL → GEWRRKTKPWRRA in isoform 4.
VSP_026504Add
BLAST
Alternative sequencei1269 – 131749Missing in isoform 4.
VSP_026505Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti173 – 1731F → L in BAC86509. 1 Publication
Sequence conflicti326 – 3261K → M in BAC86036. 1 Publication
Sequence conflicti384 – 39916Missing in BAC86509. 1 Publication
Add
BLAST
Sequence conflicti403 – 47371FLHSD…SLLDG → LCLLPQCLGGLPPTDTSVYS SASSDCCGCSMPVLCIMGHK PHVTVDT in BAC86509. 1 Publication
Add
BLAST
Sequence conflicti409 – 4091H → D in BAC86036. 1 Publication
Sequence conflicti874 – 8741W → S in BAB71033. 1 Publication
Sequence conflicti892 – 8965SLPKL → RLLPQ in BAC56931. 1 Publication
Sequence conflicti1016 – 102712SIFSV…DQQIE → WERAHLSPVRPQ in BAB15733. 1 Publication
Add
BLAST
Sequence conflicti1027 – 10271E → EQ in CAH56483. 1 Publication
Sequence conflicti1055 – 10551W → R in BAB15733. 1 Publication
Sequence conflicti1055 – 10551W → R in BAB71033. 1 Publication
Sequence conflicti1055 – 10551W → R in BAC56931. 1 Publication
Sequence conflicti1055 – 10551W → R in BAC86036. 1 Publication
Sequence conflicti1055 – 10551W → R in AAH25663. 1 Publication
Sequence conflicti1055 – 10551W → R in CAH56322. 1 Publication
Sequence conflicti1055 – 10551W → R in CAH56483. 1 Publication
Sequence conflicti1140 – 11401V → VV in CAH56483. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK024443 mRNA. Translation: BAB15733.1.
AK055880 mRNA. Translation: BAB71033.1. Different initiation.
AK122590 mRNA. Translation: BAC56931.1.
AK125060 mRNA. Translation: BAC86036.1.
AK126267 mRNA. Translation: BAC86509.1.
AL365502 Genomic DNA. Translation: CAI14579.1. Sequence problems.
BC025663 mRNA. Translation: AAH25663.1.
AL832944 mRNA. Translation: CAH56322.1.
AL832856 mRNA. Translation: CAH56483.1.
CCDSiCCDS48070.1. [Q6ZV29-5]
CCDS7045.1. [Q6ZV29-1]
RefSeqiNP_001092007.2. NM_001098537.2.
NP_689499.4. NM_152286.4.
UniGeneiHs.294147.

Genome annotation databases

EnsembliENST00000277531; ENSP00000277531; ENSG00000130653. [Q6ZV29-1]
ENST00000406427; ENSP00000384610; ENSG00000130653. [Q6ZV29-5]
GeneIDi375775.
KEGGihsa:375775.
UCSCiuc004cnf.2. human. [Q6ZV29-1]
uc010ncj.1. human. [Q6ZV29-5]

Polymorphism databases

DMDMi296452996.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK024443 mRNA. Translation: BAB15733.1 .
AK055880 mRNA. Translation: BAB71033.1 . Different initiation.
AK122590 mRNA. Translation: BAC56931.1 .
AK125060 mRNA. Translation: BAC86036.1 .
AK126267 mRNA. Translation: BAC86509.1 .
AL365502 Genomic DNA. Translation: CAI14579.1 . Sequence problems.
BC025663 mRNA. Translation: AAH25663.1 .
AL832944 mRNA. Translation: CAH56322.1 .
AL832856 mRNA. Translation: CAH56483.1 .
CCDSi CCDS48070.1. [Q6ZV29-5 ]
CCDS7045.1. [Q6ZV29-1 ]
RefSeqi NP_001092007.2. NM_001098537.2.
NP_689499.4. NM_152286.4.
UniGenei Hs.294147.

3D structure databases

ProteinModelPortali Q6ZV29.
SMRi Q6ZV29. Positions 410-661.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q6ZV29.

Polymorphism databases

DMDMi 296452996.

Proteomic databases

MaxQBi Q6ZV29.
PaxDbi Q6ZV29.
PRIDEi Q6ZV29.

Protocols and materials databases

DNASUi 375775.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000277531 ; ENSP00000277531 ; ENSG00000130653 . [Q6ZV29-1 ]
ENST00000406427 ; ENSP00000384610 ; ENSG00000130653 . [Q6ZV29-5 ]
GeneIDi 375775.
KEGGi hsa:375775.
UCSCi uc004cnf.2. human. [Q6ZV29-1 ]
uc010ncj.1. human. [Q6ZV29-5 ]

Organism-specific databases

CTDi 375775.
GeneCardsi GC09M140354.
H-InvDB HIX0201358.
HGNCi HGNC:24768. PNPLA7.
HPAi HPA009130.
MIMi 612122. gene.
neXtProti NX_Q6ZV29.
PharmGKBi PA134935962.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0664.
HOVERGENi HBG053067.
InParanoidi Q6ZV29.
KOi K14676.
OMAi MACDRAR.
PhylomeDBi Q6ZV29.
TreeFami TF300519.

Miscellaneous databases

ChiTaRSi PNPLA7. human.
GenomeRNAii 375775.
NextBioi 100611.
PROi Q6ZV29.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q6ZV29.
Bgeei Q6ZV29.
Genevestigatori Q6ZV29.

Family and domain databases

Gene3Di 2.60.120.10. 3 hits.
InterProi IPR016035. Acyl_Trfase/lysoPLipase.
IPR018490. cNMP-bd-like.
IPR000595. cNMP-bd_dom.
IPR002641. Patatin/PLipase_A2-rel.
IPR014710. RmlC-like_jellyroll.
[Graphical view ]
Pfami PF00027. cNMP_binding. 3 hits.
PF01734. Patatin. 1 hit.
[Graphical view ]
SMARTi SM00100. cNMP. 3 hits.
[Graphical view ]
SUPFAMi SSF51206. SSF51206. 3 hits.
SSF52151. SSF52151. 1 hit.
PROSITEi PS50042. CNMP_BINDING_3. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1016-1268 (ISOFORM 4), VARIANTS ALA-803 AND ASN-1050.
    Tissue: Liver, Spleen, Thalamus and Trachea.
  2. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 688-1317 (ISOFORM 1), VARIANTS ALA-803 AND LEU-908.
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 721-1317 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 897-1317 (ISOFORM 3), VARIANT ALA-803.
    Tissue: Lymph node and Stomach.

Entry informationi

Entry nameiPLPL7_HUMAN
AccessioniPrimary (citable) accession number: Q6ZV29
Secondary accession number(s): B5MDD3
, Q5T364, Q658X0, Q658Y3, Q6ZTS1, Q86YU8, Q8TAY5, Q96N75, Q9H7N5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: May 18, 2010
Last modified: September 3, 2014
This is version 94 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi