Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C15orf52

Gene

C15orf52

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:G66-30779-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C15orf52
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:33488. C15orf52.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000188549.
PharmGKBiPA162378161.

Polymorphism and mutation databases

BioMutaiC15orf52.
DMDMi74712068.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002957331 – 534Uncharacterized protein C15orf52Add BLAST534

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei201PhosphoserineCombined sources1
Modified residuei392PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6ZUT6.
MaxQBiQ6ZUT6.
PaxDbiQ6ZUT6.
PeptideAtlasiQ6ZUT6.
PRIDEiQ6ZUT6.

PTM databases

iPTMnetiQ6ZUT6.
PhosphoSitePlusiQ6ZUT6.

Expressioni

Gene expression databases

BgeeiENSG00000188549.
CleanExiHS_C15orf52.
ExpressionAtlasiQ6ZUT6. baseline and differential.
GenevisibleiQ6ZUT6. HS.

Organism-specific databases

HPAiHPA040484.
HPA041834.

Interactioni

Protein-protein interaction databases

BioGridi132557. 4 interactors.
IntActiQ6ZUT6. 2 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ6ZUT6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili60 – 97Sequence analysisAdd BLAST38

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IKY1. Eukaryota.
ENOG410YRQX. LUCA.
GeneTreeiENSGT00530000063950.
HOGENOMiHOG000111857.
HOVERGENiHBG097225.
InParanoidiQ6ZUT6.
OMAiMISCAEQ.
OrthoDBiEOG091G042W.
PhylomeDBiQ6ZUT6.
TreeFamiTF336272.

Family and domain databases

InterProiIPR029336. DUF4594.
[Graphical view]
PANTHERiPTHR15635. PTHR15635. 1 hit.
PfamiPF15266. DUF4594. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZUT6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MISCAEQRSR QGEAGRGPAP VAPAFLPLWL PRGCSGILSV PAVAMHSAGT
60 70 80 90 100
PRAESPMSRQ EKDAELDRRI VALRKKNQAL LRRYQEIQED RRQAEQGGMA
110 120 130 140 150
VTTPALLQPD GLTVTISQVP GEKRVVSRNW ARGTCGPRVT NEMLEDEDAE
160 170 180 190 200
DHGGTFCLGE LVELAVTMEN KAEGKRIVSE KPTRARNQGI EGSPGGRVTR
210 220 230 240 250
SPPTQVAISS DSARKGSWEP WSRPVGEPPE AGWDYAQWKQ EREQIDLARL
260 270 280 290 300
ARHRDAQGDW RRPWDLDKAK STLQDCSQLR GEGPARAGSR RGPRSHQKLQ
310 320 330 340 350
PPPLLPDGKG RGGQASRPSV APATGSKARG KERLTGRARR WDMKEDKEEL
360 370 380 390 400
EGQEGSQSTR ETPSEEEQAQ KQSGMEQGRL GSAPAASPAL ASPEGPKGES
410 420 430 440 450
VASTASSVPC SPQEPDLAPL DLSLGGAGIP GPRESGCVLG LRPGAQESPV
460 470 480 490 500
SWPEGSKQQP LGWSNHQAEL EVQTCPEPQR GAGLPEPGED RSGKSGAQQG
510 520 530
LAPRSRPTRG GSQRSRGTAG VRRRTGRPGP AGRC
Length:534
Mass (Da):57,325
Last modified:July 5, 2004 - v1
Checksum:i6439262849AB35D1
GO
Isoform 2 (identifier: Q6ZUT6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-210: Missing.
     211-215: DSARK → MRHRE

Note: No experimental confirmation available.
Show »
Length:324
Mass (Da):34,763
Checksum:i9C3EF79E502EF184
GO
Isoform 3 (identifier: Q6ZUT6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     69-121: RIVALRKKNQ...LTVTISQVPG → MPLACEHPVG...PCGLRVFVLQ
     293-325: PRSHQKLQPPPLLPDGKGRGGQASRPSVAPATG → EPTPTSSLPSLALFIFHPLVLSFLCLLVSYFQS
     326-534: Missing.

Note: No experimental confirmation available.
Show »
Length:257
Mass (Da):28,191
Checksum:i335D05EA20EA7AFE
GO
Isoform 4 (identifier: Q6ZUT6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     69-121: RIVALRKKNQ...LTVTISQVPG → MPLACEHPVG...PCGLRVFVLQ

Note: No experimental confirmation available.
Show »
Length:466
Mass (Da):49,681
Checksum:iDF09A4B61046CD41
GO

Sequence cautioni

The sequence CAH18251 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti236A → T in BAC86405 (PubMed:14702039).Curated1
Sequence conflicti316S → N in BAC86405 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035620189G → E in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0270371 – 210Missing in isoform 2. 2 PublicationsAdd BLAST210
Alternative sequenceiVSP_0270381 – 68Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST68
Alternative sequenceiVSP_02703969 – 121RIVAL…SQVPG → MPLACEHPVGVSSSVGNAGR AGVGTQAWGTTERTQHPGPA QHCPCGLRVFVLQ in isoform 3 and isoform 4. 2 PublicationsAdd BLAST53
Alternative sequenceiVSP_027040211 – 215DSARK → MRHRE in isoform 2. 2 Publications5
Alternative sequenceiVSP_027041293 – 325PRSHQ…APATG → EPTPTSSLPSLALFIFHPLV LSFLCLLVSYFQS in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_027042326 – 534Missing in isoform 3. 1 PublicationAdd BLAST209

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125329 mRNA. Translation: BAC86132.1.
AK126035 mRNA. Translation: BAC86405.1.
AK126485 mRNA. No translation available.
CH471125 Genomic DNA. Translation: EAW92404.1.
BC140897 mRNA. Translation: AAI40898.1.
BC140902 mRNA. Translation: AAI40903.1.
CR749408 mRNA. Translation: CAH18251.1. Different initiation.
CCDSiCCDS10055.2. [Q6ZUT6-1]
RefSeqiNP_997263.2. NM_207380.2. [Q6ZUT6-1]
UniGeneiHs.32433.

Genome annotation databases

EnsembliENST00000397536; ENSP00000380670; ENSG00000188549. [Q6ZUT6-2]
ENST00000559313; ENSP00000453969; ENSG00000188549. [Q6ZUT6-1]
GeneIDi388115.
KEGGihsa:388115.
UCSCiuc001zlh.5. human. [Q6ZUT6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125329 mRNA. Translation: BAC86132.1.
AK126035 mRNA. Translation: BAC86405.1.
AK126485 mRNA. No translation available.
CH471125 Genomic DNA. Translation: EAW92404.1.
BC140897 mRNA. Translation: AAI40898.1.
BC140902 mRNA. Translation: AAI40903.1.
CR749408 mRNA. Translation: CAH18251.1. Different initiation.
CCDSiCCDS10055.2. [Q6ZUT6-1]
RefSeqiNP_997263.2. NM_207380.2. [Q6ZUT6-1]
UniGeneiHs.32433.

3D structure databases

ProteinModelPortaliQ6ZUT6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi132557. 4 interactors.
IntActiQ6ZUT6. 2 interactors.

PTM databases

iPTMnetiQ6ZUT6.
PhosphoSitePlusiQ6ZUT6.

Polymorphism and mutation databases

BioMutaiC15orf52.
DMDMi74712068.

Proteomic databases

EPDiQ6ZUT6.
MaxQBiQ6ZUT6.
PaxDbiQ6ZUT6.
PeptideAtlasiQ6ZUT6.
PRIDEiQ6ZUT6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000397536; ENSP00000380670; ENSG00000188549. [Q6ZUT6-2]
ENST00000559313; ENSP00000453969; ENSG00000188549. [Q6ZUT6-1]
GeneIDi388115.
KEGGihsa:388115.
UCSCiuc001zlh.5. human. [Q6ZUT6-1]

Organism-specific databases

CTDi388115.
GeneCardsiC15orf52.
H-InvDBHIX0026791.
HGNCiHGNC:33488. C15orf52.
HPAiHPA040484.
HPA041834.
neXtProtiNX_Q6ZUT6.
OpenTargetsiENSG00000188549.
PharmGKBiPA162378161.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKY1. Eukaryota.
ENOG410YRQX. LUCA.
GeneTreeiENSGT00530000063950.
HOGENOMiHOG000111857.
HOVERGENiHBG097225.
InParanoidiQ6ZUT6.
OMAiMISCAEQ.
OrthoDBiEOG091G042W.
PhylomeDBiQ6ZUT6.
TreeFamiTF336272.

Enzyme and pathway databases

BioCyciZFISH:G66-30779-MONOMER.

Miscellaneous databases

GenomeRNAii388115.
PROiQ6ZUT6.

Gene expression databases

BgeeiENSG00000188549.
CleanExiHS_C15orf52.
ExpressionAtlasiQ6ZUT6. baseline and differential.
GenevisibleiQ6ZUT6. HS.

Family and domain databases

InterProiIPR029336. DUF4594.
[Graphical view]
PANTHERiPTHR15635. PTHR15635. 1 hit.
PfamiPF15266. DUF4594. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCO052_HUMAN
AccessioniPrimary (citable) accession number: Q6ZUT6
Secondary accession number(s): B9EIQ8
, Q68DG9, Q6ZTM3, Q6ZU22
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 5, 2004
Last modified: November 2, 2016
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.