Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 9B

Gene

CCDC9B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 9BImported
Gene namesi
Name:CCDC9BImported
Synonyms:C15orf52Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000188549.12
HGNCiHGNC:33488 CCDC9B
neXtProtiNX_Q6ZUT6

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000188549
PharmGKBiPA162378161

Polymorphism and mutation databases

BioMutaiC15orf52
DMDMi74712068

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002957331 – 534Coiled-coil domain-containing protein 9BAdd BLAST534

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei201PhosphoserineCombined sources1
Modified residuei392PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6ZUT6
MaxQBiQ6ZUT6
PaxDbiQ6ZUT6
PeptideAtlasiQ6ZUT6
PRIDEiQ6ZUT6

PTM databases

iPTMnetiQ6ZUT6
PhosphoSitePlusiQ6ZUT6

Expressioni

Gene expression databases

BgeeiENSG00000188549
CleanExiHS_C15orf52
ExpressionAtlasiQ6ZUT6 baseline and differential
GenevisibleiQ6ZUT6 HS

Organism-specific databases

HPAiHPA040484
HPA041834

Interactioni

Protein-protein interaction databases

BioGridi132557, 5 interactors
IntActiQ6ZUT6, 2 interactors
STRINGi9606.ENSP00000453969

Structurei

3D structure databases

ProteinModelPortaliQ6ZUT6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili60 – 97Sequence analysisAdd BLAST38

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IKY1 Eukaryota
ENOG410YRQX LUCA
GeneTreeiENSGT00530000063950
HOGENOMiHOG000111857
HOVERGENiHBG097225
InParanoidiQ6ZUT6
OMAiMISCAEQ
OrthoDBiEOG091G042W
PhylomeDBiQ6ZUT6
TreeFamiTF336272

Family and domain databases

InterProiView protein in InterPro
IPR029336 DUF4594
PANTHERiPTHR15635 PTHR15635, 1 hit
PfamiView protein in Pfam
PF15266 DUF4594, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZUT6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MISCAEQRSR QGEAGRGPAP VAPAFLPLWL PRGCSGILSV PAVAMHSAGT
60 70 80 90 100
PRAESPMSRQ EKDAELDRRI VALRKKNQAL LRRYQEIQED RRQAEQGGMA
110 120 130 140 150
VTTPALLQPD GLTVTISQVP GEKRVVSRNW ARGTCGPRVT NEMLEDEDAE
160 170 180 190 200
DHGGTFCLGE LVELAVTMEN KAEGKRIVSE KPTRARNQGI EGSPGGRVTR
210 220 230 240 250
SPPTQVAISS DSARKGSWEP WSRPVGEPPE AGWDYAQWKQ EREQIDLARL
260 270 280 290 300
ARHRDAQGDW RRPWDLDKAK STLQDCSQLR GEGPARAGSR RGPRSHQKLQ
310 320 330 340 350
PPPLLPDGKG RGGQASRPSV APATGSKARG KERLTGRARR WDMKEDKEEL
360 370 380 390 400
EGQEGSQSTR ETPSEEEQAQ KQSGMEQGRL GSAPAASPAL ASPEGPKGES
410 420 430 440 450
VASTASSVPC SPQEPDLAPL DLSLGGAGIP GPRESGCVLG LRPGAQESPV
460 470 480 490 500
SWPEGSKQQP LGWSNHQAEL EVQTCPEPQR GAGLPEPGED RSGKSGAQQG
510 520 530
LAPRSRPTRG GSQRSRGTAG VRRRTGRPGP AGRC
Length:534
Mass (Da):57,325
Last modified:July 5, 2004 - v1
Checksum:i6439262849AB35D1
GO
Isoform 2 (identifier: Q6ZUT6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-210: Missing.
     211-215: DSARK → MRHRE

Note: No experimental confirmation available.
Show »
Length:324
Mass (Da):34,763
Checksum:i9C3EF79E502EF184
GO
Isoform 3 (identifier: Q6ZUT6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     69-121: RIVALRKKNQ...LTVTISQVPG → MPLACEHPVG...PCGLRVFVLQ
     293-325: PRSHQKLQPPPLLPDGKGRGGQASRPSVAPATG → EPTPTSSLPSLALFIFHPLVLSFLCLLVSYFQS
     326-534: Missing.

Note: No experimental confirmation available.
Show »
Length:257
Mass (Da):28,191
Checksum:i335D05EA20EA7AFE
GO
Isoform 4 (identifier: Q6ZUT6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     69-121: RIVALRKKNQ...LTVTISQVPG → MPLACEHPVG...PCGLRVFVLQ

Note: No experimental confirmation available.
Show »
Length:466
Mass (Da):49,681
Checksum:iDF09A4B61046CD41
GO

Sequence cautioni

The sequence CAH18251 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti236A → T in BAC86405 (PubMed:14702039).Curated1
Sequence conflicti316S → N in BAC86405 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035620189G → E in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0270371 – 210Missing in isoform 2. 2 PublicationsAdd BLAST210
Alternative sequenceiVSP_0270381 – 68Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST68
Alternative sequenceiVSP_02703969 – 121RIVAL…SQVPG → MPLACEHPVGVSSSVGNAGR AGVGTQAWGTTERTQHPGPA QHCPCGLRVFVLQ in isoform 3 and isoform 4. 2 PublicationsAdd BLAST53
Alternative sequenceiVSP_027040211 – 215DSARK → MRHRE in isoform 2. 2 Publications5
Alternative sequenceiVSP_027041293 – 325PRSHQ…APATG → EPTPTSSLPSLALFIFHPLV LSFLCLLVSYFQS in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_027042326 – 534Missing in isoform 3. 1 PublicationAdd BLAST209

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125329 mRNA Translation: BAC86132.1
AK126035 mRNA Translation: BAC86405.1
AK126485 mRNA No translation available.
CH471125 Genomic DNA Translation: EAW92404.1
BC140897 mRNA Translation: AAI40898.1
BC140902 mRNA Translation: AAI40903.1
CR749408 mRNA Translation: CAH18251.1 Different initiation.
CCDSiCCDS10055.2 [Q6ZUT6-1]
RefSeqiNP_997263.2, NM_207380.2 [Q6ZUT6-1]
UniGeneiHs.32433

Genome annotation databases

EnsembliENST00000397536; ENSP00000380670; ENSG00000188549 [Q6ZUT6-2]
ENST00000559313; ENSP00000453969; ENSG00000188549 [Q6ZUT6-1]
GeneIDi388115
KEGGihsa:388115
UCSCiuc001zlh.5 human [Q6ZUT6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCCD9B_HUMAN
AccessioniPrimary (citable) accession number: Q6ZUT6
Secondary accession number(s): B9EIQ8
, Q68DG9, Q6ZTM3, Q6ZU22
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 5, 2004
Last modified: March 28, 2018
This is version 93 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health