Q6ZU80 (CE128_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 71.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Centrosomal protein of 128 kDa | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1094 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Cytoplasm › cytoskeleton › centrosome › centriole. Cytoplasm › cytoskeleton › spindle pole. Note: Associates with the mother centriole. Ref.4 |
| Sequence caution | The sequence BAB71273.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | centriole Inferred from direct assay Ref.4. Source: UniProtKB spindle poleInferred from direct assay Ref.4. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q6ZU80-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q6ZU80-1) The sequence of this isoform differs from the canonical sequence as follows: 987-987: D → R 988-1094: Missing. | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: Q6ZU80-3) The sequence of this isoform differs from the canonical sequence as follows: 404-435: NLTRELENGEKQQLQMLDRLKEIQNHFDTCEA → HINRKCLLNLVQDLDCKDNEILTYSLQSPLHV 436-1094: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1094 | 1094 | Centrosomal protein of 128 kDa | PRO_0000089946 | |||||
Regions | |||||||||
| Coiled coil | 190 – 827 | 638 | Potential | ||||||
| Coiled coil | 879 – 959 | 81 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 404 – 435 | 32 | NLTRE…DTCEA → HINRKCLLNLVQDLDCKDNE ILTYSLQSPLHV in isoform 3. | VSP_030194 | |||||
| Alternative sequence | 436 – 1094 | 659 | Missing in isoform 3. | VSP_030195 | |||||
| Alternative sequence | 987 | 1 | D → R in isoform 1. | VSP_014752 | |||||
| Alternative sequence | 988 – 1094 | 107 | Missing in isoform 1. | VSP_030196 | |||||
| Natural variant | 16 | 1 | R → L. Corresponds to variant rs7160694 [ dbSNP | Ensembl ]. | VAR_037835 | |||||
| Natural variant | 732 | 1 | H → R. Corresponds to variant rs327463 [ dbSNP | Ensembl ]. | VAR_037836 | |||||
Experimental info | |||||||||
| Sequence conflict | 395 | 1 | K → R in AAH45834. Ref.2 | ||||||
| Sequence conflict | 973 | 1 | P → A in BAB71273. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 310-1094 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 715-1094 (ISOFORM 1). Tissue: Placenta and Testis. |
| [4] | "Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods." Jakobsen L., Vanselow K., Skogs M., Toyoda Y., Lundberg E., Poser I., Falkenby L.G., Bennetzen M., Westendorf J., Nigg E.A., Uhlen M., Hyman A.A., Andersen J.S. EMBO J. 30:1520-1535(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC010072 Genomic DNA. No translation available. AC022404 Genomic DNA. No translation available. AC018513 Genomic DNA. No translation available. BC045834 mRNA. Translation: AAH45834.2. BC150610 mRNA. Translation: AAI50611.1. AK056756 mRNA. Translation: BAB71273.1. Different initiation. AK125925 mRNA. No translation available. |
| IPI | IPI00607659. IPI00719446. IPI00742787. |
| RefSeq | NP_689659.2. NM_152446.3. |
| UniGene | Hs.162889. |
3D structure databases | |
| ProteinModelPortal | Q6ZU80. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6ZU80. 2 interactions. |
| STRING | 9606.ENSP00000281129. |
PTM databases | |
| PhosphoSite | Q6ZU80. |
Polymorphism databases | |
| DMDM | 166214932. |
Proteomic databases | |
| PaxDb | Q6ZU80. |
| PRIDE | Q6ZU80. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000216517; ENSP00000216517; ENSG00000100629. ENST00000281129; ENSP00000281129; ENSG00000100629. ENST00000555265; ENSP00000451162; ENSG00000100629. |
| GeneID | 145508. |
| KEGG | hsa:145508. |
| UCSC | uc001xux.2. human. uc001xuz.2. human. |
Organism-specific databases | |
| CTD | 145508. |
| GeneCards | GC14M080963. |
| H-InvDB | HIX0011861. |
| HGNC | HGNC:20359. CEP128. |
| HPA | HPA001116. HPA018498. |
| neXtProt | NX_Q6ZU80. |
| PharmGKB | PA142672283. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG27482. |
| HOVERGEN | HBG106663. |
| InParanoid | Q6ZU80. |
| KO | K16460. |
| OMA | RKGLQHQ. |
| OrthoDB | EOG44XJG2. |
Gene expression databases | |
| ArrayExpress | Q6ZU80. |
| Bgee | Q6ZU80. |
| CleanEx | HS_C14orf145. |
| Genevestigator | Q6ZU80. |
| GermOnline | ENSG00000100629. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR026652. CEP128. [Graphical view] |
| PANTHER | PTHR18937:SF5. PTHR18937:SF5. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CEP128. human. |
| GenomeRNAi | 145508. |
| NextBio | 85130. |
Entry information
| Entry name | CE128_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6ZU80 Secondary accession number(s): B9EK52, Q86X97, Q96ML4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with
