SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6ZU80

- CE128_HUMAN

UniProt

Q6ZU80 - CE128_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Centrosomal protein of 128 kDa
Gene
CEP128, C14orf145, C14orf61
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Centrosomal protein of 128 kDa
Short name:
Cep128
Gene namesi
Name:CEP128
Synonyms:C14orf145, C14orf61
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:20359. CEP128.

Subcellular locationi

Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole. Cytoplasmcytoskeletonspindle pole
Note: Associates with the mother centriole.1 Publication

GO - Cellular componenti

  1. centriole Source: UniProtKB
  2. cytoplasm Source: HPA
  3. microtubule organizing center Source: HPA
  4. spindle pole Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672283.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10941094Centrosomal protein of 128 kDa
PRO_0000089946Add
BLAST

Proteomic databases

MaxQBiQ6ZU80.
PaxDbiQ6ZU80.
PRIDEiQ6ZU80.

PTM databases

PhosphoSiteiQ6ZU80.

Expressioni

Gene expression databases

ArrayExpressiQ6ZU80.
BgeeiQ6ZU80.
CleanExiHS_C14orf145.
GenevestigatoriQ6ZU80.

Organism-specific databases

HPAiHPA000602.
HPA001116.
HPA018498.

Interactioni

Protein-protein interaction databases

BioGridi126920. 1 interaction.
IntActiQ6ZU80. 2 interactions.
STRINGi9606.ENSP00000281129.

Structurei

3D structure databases

ProteinModelPortaliQ6ZU80.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili190 – 827638 Reviewed prediction
Add
BLAST
Coiled coili879 – 95981 Reviewed prediction
Add
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG27482.
HOVERGENiHBG106663.
InParanoidiQ6ZU80.
KOiK16460.
OMAiRVQLNFN.
PhylomeDBiQ6ZU80.
TreeFamiTF331714.

Family and domain databases

InterProiIPR026652. CEP128.
[Graphical view]
PANTHERiPTHR18937:SF149. PTHR18937:SF149. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 2 (identifier: Q6ZU80-2) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAESSSESDH FRCRDRLSPW AARSTHRGTR SLPTVEVTEK VNTITSTLQD     50
TSRNLRQVDQ MLGRYREYSN GQAGAIEHLK ESLEQSIDQL RSQRLLRNSG 100
GRSISVTSLS ASDLDGGTGS ELHHFPPTSP LKDYGDPQGI KRMRSRTGVR 150
FVQETDDMTQ LHGFHQSLRD LSSEQIRLGD DFNRELSRRS RSDAETKRAL 200
EELTEKLNEA QKQEVVSDRV ERRLQELERE MRTERELVER RQDQLGLMSL 250
QLQEALKKQE AKADEHEGAI KNKLRQTETE KNQLEQELEL SRRLLNQSEG 300
SRETLLHQVE ELRTQLTKAE GDRKGLQHQV SQISKQQSNY QDEQGEDWRF 350
RRGVEREKQD LEKQMSDLRV QLNFSAMASE LEEVKRCMER KDKEKAHLAS 400
QVENLTRELE NGEKQQLQML DRLKEIQNHF DTCEAERKHA DLQISELTRH 450
AEDATKQAER YLSELQQSEA LKEEAEKRRE DLKLKAQESI RQWKLKHKKL 500
ERALEKQSET VDELTGKNNQ ILKEKDELKT QLYAALQQIE NLRKELNDVL 550
TKRALQEEEL HSKEEKLRDI KSHQADLELE VKNSLDTIHR LESELKKQSK 600
IQSQMKVEKA HLEEEIAELK KSQAQDKAKL LEMQESIKDL SAIRADLANK 650
LAEEERAKKA VLKDLSDLTA QAKSRDEETA TIITQLKLER DVHQRELKDL 700
TSSLQSVKTK HEQNIQELMK HFKKEKSEAE NHIRTLKAES LEEKNMAKIH 750
RGQLEKLKSQ CDRLTEELTQ NENENKKLKL KYQCLKDQLE EREKHISIEE 800
EHLRRMEEAR LQLKDQLLCL ETEQESILGV IGKEIDAACK TFSKDSVEKL 850
KVFSSGPDIH YDPHRWLAES KTKLQWLCEE LKERENREKN LRHQLMLCRQ 900
QLRNLTENKE SELQCLFQQI ERQEQLLDEI HREKRDLLEE TQRKDEEMGS 950
LQDRVIALET STQVALDHLE SVPEKLSLLE DFKDFRDSCS SSERTDGRYS 1000
KYRVRRNSLQ HHQDDTKYRT KSFKGDRTFL EGSHTRGLDH SSSWQDHSRF 1050
LSSPRFSYVN SFTKRTVAPD SASNKEDATM NGTSSQPKKE EYGS 1094
Length:1,094
Mass (Da):128,015
Last modified:January 15, 2008 - v2
Checksum:iBDE05923E3F6B0FF
GO
Isoform 1 (identifier: Q6ZU80-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     987-987: D → R
     988-1094: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:987
Mass (Da):115,784
Checksum:i94F4A1CDF521E942
GO
Isoform 3 (identifier: Q6ZU80-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     404-435: NLTRELENGEKQQLQMLDRLKEIQNHFDTCEA → HINRKCLLNLVQDLDCKDNEILTYSLQSPLHV
     436-1094: Missing.

Note: No experimental confirmation available.

Show »
Length:435
Mass (Da):50,469
Checksum:i62BE596D8FED35E0
GO

Sequence cautioni

The sequence BAB71273.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti16 – 161R → L.
Corresponds to variant rs7160694 [ dbSNP | Ensembl ].
VAR_037835
Natural varianti732 – 7321H → R.
Corresponds to variant rs327463 [ dbSNP | Ensembl ].
VAR_037836

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei404 – 43532NLTRE…DTCEA → HINRKCLLNLVQDLDCKDNE ILTYSLQSPLHV in isoform 3.
VSP_030194Add
BLAST
Alternative sequencei436 – 1094659Missing in isoform 3.
VSP_030195Add
BLAST
Alternative sequencei987 – 9871D → R in isoform 1.
VSP_014752
Alternative sequencei988 – 1094107Missing in isoform 1.
VSP_030196Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti395 – 3951K → R in AAH45834. 1 Publication
Sequence conflicti973 – 9731P → A in BAB71273. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC010072 Genomic DNA. No translation available.
AC022404 Genomic DNA. No translation available.
AC018513 Genomic DNA. No translation available.
BC045834 mRNA. Translation: AAH45834.2.
BC150610 mRNA. Translation: AAI50611.1.
AK056756 mRNA. Translation: BAB71273.1. Different initiation.
AK125925 mRNA. No translation available.
CCDSiCCDS32130.1. [Q6ZU80-2]
RefSeqiNP_689659.2. NM_152446.3. [Q6ZU80-2]
XP_006720119.1. XM_006720056.1. [Q6ZU80-2]
UniGeneiHs.162889.

Genome annotation databases

EnsembliENST00000216517; ENSP00000216517; ENSG00000100629. [Q6ZU80-3]
ENST00000281129; ENSP00000281129; ENSG00000100629. [Q6ZU80-2]
ENST00000555265; ENSP00000451162; ENSG00000100629. [Q6ZU80-2]
GeneIDi145508.
KEGGihsa:145508.
UCSCiuc001xux.2. human. [Q6ZU80-2]

Polymorphism databases

DMDMi166214932.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC010072 Genomic DNA. No translation available.
AC022404 Genomic DNA. No translation available.
AC018513 Genomic DNA. No translation available.
BC045834 mRNA. Translation: AAH45834.2 .
BC150610 mRNA. Translation: AAI50611.1 .
AK056756 mRNA. Translation: BAB71273.1 . Different initiation.
AK125925 mRNA. No translation available.
CCDSi CCDS32130.1. [Q6ZU80-2 ]
RefSeqi NP_689659.2. NM_152446.3. [Q6ZU80-2 ]
XP_006720119.1. XM_006720056.1. [Q6ZU80-2 ]
UniGenei Hs.162889.

3D structure databases

ProteinModelPortali Q6ZU80.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 126920. 1 interaction.
IntActi Q6ZU80. 2 interactions.
STRINGi 9606.ENSP00000281129.

PTM databases

PhosphoSitei Q6ZU80.

Polymorphism databases

DMDMi 166214932.

Proteomic databases

MaxQBi Q6ZU80.
PaxDbi Q6ZU80.
PRIDEi Q6ZU80.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000216517 ; ENSP00000216517 ; ENSG00000100629 . [Q6ZU80-3 ]
ENST00000281129 ; ENSP00000281129 ; ENSG00000100629 . [Q6ZU80-2 ]
ENST00000555265 ; ENSP00000451162 ; ENSG00000100629 . [Q6ZU80-2 ]
GeneIDi 145508.
KEGGi hsa:145508.
UCSCi uc001xux.2. human. [Q6ZU80-2 ]

Organism-specific databases

CTDi 145508.
GeneCardsi GC14M080963.
H-InvDB HIX0011861.
HGNCi HGNC:20359. CEP128.
HPAi HPA000602.
HPA001116.
HPA018498.
neXtProti NX_Q6ZU80.
PharmGKBi PA142672283.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG27482.
HOVERGENi HBG106663.
InParanoidi Q6ZU80.
KOi K16460.
OMAi RVQLNFN.
PhylomeDBi Q6ZU80.
TreeFami TF331714.

Miscellaneous databases

ChiTaRSi CEP128. human.
GenomeRNAii 145508.
NextBioi 85130.
PROi Q6ZU80.

Gene expression databases

ArrayExpressi Q6ZU80.
Bgeei Q6ZU80.
CleanExi HS_C14orf145.
Genevestigatori Q6ZU80.

Family and domain databases

InterProi IPR026652. CEP128.
[Graphical view ]
PANTHERi PTHR18937:SF149. PTHR18937:SF149. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 310-1094 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 715-1094 (ISOFORM 1).
    Tissue: Placenta and Testis.
  4. "Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods."
    Jakobsen L., Vanselow K., Skogs M., Toyoda Y., Lundberg E., Poser I., Falkenby L.G., Bennetzen M., Westendorf J., Nigg E.A., Uhlen M., Hyman A.A., Andersen J.S.
    EMBO J. 30:1520-1535(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiCE128_HUMAN
AccessioniPrimary (citable) accession number: Q6ZU80
Secondary accession number(s): B9EK52, Q86X97, Q96ML4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: January 15, 2008
Last modified: July 9, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

External Data

Dasty 3

Similar proteinsi