Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6ZU80

- CE128_HUMAN

UniProt

Q6ZU80 - CE128_HUMAN

Protein

Centrosomal protein of 128 kDa

Gene

CEP128

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 83 (01 Oct 2014)
      Sequence version 2 (15 Jan 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Centrosomal protein of 128 kDa
    Short name:
    Cep128
    Gene namesi
    Name:CEP128
    Synonyms:C14orf145, C14orf61
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:20359. CEP128.

    Subcellular locationi

    Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole 1 Publication. Cytoplasmcytoskeletonspindle pole 1 Publication
    Note: Associates with the mother centriole.

    GO - Cellular componenti

    1. centriole Source: UniProtKB
    2. cytoplasm Source: HPA
    3. microtubule organizing center Source: HPA
    4. spindle pole Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672283.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10941094Centrosomal protein of 128 kDaPRO_0000089946Add
    BLAST

    Proteomic databases

    MaxQBiQ6ZU80.
    PaxDbiQ6ZU80.
    PRIDEiQ6ZU80.

    PTM databases

    PhosphoSiteiQ6ZU80.

    Expressioni

    Gene expression databases

    ArrayExpressiQ6ZU80.
    BgeeiQ6ZU80.
    CleanExiHS_C14orf145.
    GenevestigatoriQ6ZU80.

    Organism-specific databases

    HPAiHPA000602.
    HPA001116.
    HPA018498.

    Interactioni

    Protein-protein interaction databases

    BioGridi126920. 1 interaction.
    IntActiQ6ZU80. 2 interactions.
    STRINGi9606.ENSP00000281129.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6ZU80.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili190 – 827638Sequence AnalysisAdd
    BLAST
    Coiled coili879 – 95981Sequence AnalysisAdd
    BLAST

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG27482.
    HOVERGENiHBG106663.
    InParanoidiQ6ZU80.
    KOiK16460.
    OMAiRVQLNFN.
    PhylomeDBiQ6ZU80.
    TreeFamiTF331714.

    Family and domain databases

    InterProiIPR026652. CEP128.
    [Graphical view]
    PANTHERiPTHR18937:SF149. PTHR18937:SF149. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: Q6ZU80-2) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAESSSESDH FRCRDRLSPW AARSTHRGTR SLPTVEVTEK VNTITSTLQD     50
    TSRNLRQVDQ MLGRYREYSN GQAGAIEHLK ESLEQSIDQL RSQRLLRNSG 100
    GRSISVTSLS ASDLDGGTGS ELHHFPPTSP LKDYGDPQGI KRMRSRTGVR 150
    FVQETDDMTQ LHGFHQSLRD LSSEQIRLGD DFNRELSRRS RSDAETKRAL 200
    EELTEKLNEA QKQEVVSDRV ERRLQELERE MRTERELVER RQDQLGLMSL 250
    QLQEALKKQE AKADEHEGAI KNKLRQTETE KNQLEQELEL SRRLLNQSEG 300
    SRETLLHQVE ELRTQLTKAE GDRKGLQHQV SQISKQQSNY QDEQGEDWRF 350
    RRGVEREKQD LEKQMSDLRV QLNFSAMASE LEEVKRCMER KDKEKAHLAS 400
    QVENLTRELE NGEKQQLQML DRLKEIQNHF DTCEAERKHA DLQISELTRH 450
    AEDATKQAER YLSELQQSEA LKEEAEKRRE DLKLKAQESI RQWKLKHKKL 500
    ERALEKQSET VDELTGKNNQ ILKEKDELKT QLYAALQQIE NLRKELNDVL 550
    TKRALQEEEL HSKEEKLRDI KSHQADLELE VKNSLDTIHR LESELKKQSK 600
    IQSQMKVEKA HLEEEIAELK KSQAQDKAKL LEMQESIKDL SAIRADLANK 650
    LAEEERAKKA VLKDLSDLTA QAKSRDEETA TIITQLKLER DVHQRELKDL 700
    TSSLQSVKTK HEQNIQELMK HFKKEKSEAE NHIRTLKAES LEEKNMAKIH 750
    RGQLEKLKSQ CDRLTEELTQ NENENKKLKL KYQCLKDQLE EREKHISIEE 800
    EHLRRMEEAR LQLKDQLLCL ETEQESILGV IGKEIDAACK TFSKDSVEKL 850
    KVFSSGPDIH YDPHRWLAES KTKLQWLCEE LKERENREKN LRHQLMLCRQ 900
    QLRNLTENKE SELQCLFQQI ERQEQLLDEI HREKRDLLEE TQRKDEEMGS 950
    LQDRVIALET STQVALDHLE SVPEKLSLLE DFKDFRDSCS SSERTDGRYS 1000
    KYRVRRNSLQ HHQDDTKYRT KSFKGDRTFL EGSHTRGLDH SSSWQDHSRF 1050
    LSSPRFSYVN SFTKRTVAPD SASNKEDATM NGTSSQPKKE EYGS 1094
    Length:1,094
    Mass (Da):128,015
    Last modified:January 15, 2008 - v2
    Checksum:iBDE05923E3F6B0FF
    GO
    Isoform 1 (identifier: Q6ZU80-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         987-987: D → R
         988-1094: Missing.

    Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:987
    Mass (Da):115,784
    Checksum:i94F4A1CDF521E942
    GO
    Isoform 3 (identifier: Q6ZU80-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         404-435: NLTRELENGEKQQLQMLDRLKEIQNHFDTCEA → HINRKCLLNLVQDLDCKDNEILTYSLQSPLHV
         436-1094: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:435
    Mass (Da):50,469
    Checksum:i62BE596D8FED35E0
    GO

    Sequence cautioni

    The sequence BAB71273.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti395 – 3951K → R in AAH45834. (PubMed:15489334)Curated
    Sequence conflicti973 – 9731P → A in BAB71273. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti16 – 161R → L.
    Corresponds to variant rs7160694 [ dbSNP | Ensembl ].
    VAR_037835
    Natural varianti732 – 7321H → R.
    Corresponds to variant rs327463 [ dbSNP | Ensembl ].
    VAR_037836

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei404 – 43532NLTRE…DTCEA → HINRKCLLNLVQDLDCKDNE ILTYSLQSPLHV in isoform 3. 1 PublicationVSP_030194Add
    BLAST
    Alternative sequencei436 – 1094659Missing in isoform 3. 1 PublicationVSP_030195Add
    BLAST
    Alternative sequencei987 – 9871D → R in isoform 1. 1 PublicationVSP_014752
    Alternative sequencei988 – 1094107Missing in isoform 1. 1 PublicationVSP_030196Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC010072 Genomic DNA. No translation available.
    AC022404 Genomic DNA. No translation available.
    AC018513 Genomic DNA. No translation available.
    BC045834 mRNA. Translation: AAH45834.2.
    BC150610 mRNA. Translation: AAI50611.1.
    AK056756 mRNA. Translation: BAB71273.1. Different initiation.
    AK125925 mRNA. No translation available.
    CCDSiCCDS32130.1. [Q6ZU80-2]
    RefSeqiNP_689659.2. NM_152446.3. [Q6ZU80-2]
    XP_006720119.1. XM_006720056.1. [Q6ZU80-2]
    UniGeneiHs.162889.

    Genome annotation databases

    EnsembliENST00000216517; ENSP00000216517; ENSG00000100629. [Q6ZU80-3]
    ENST00000281129; ENSP00000281129; ENSG00000100629. [Q6ZU80-2]
    ENST00000555265; ENSP00000451162; ENSG00000100629. [Q6ZU80-2]
    GeneIDi145508.
    KEGGihsa:145508.
    UCSCiuc001xux.2. human. [Q6ZU80-2]

    Polymorphism databases

    DMDMi166214932.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC010072 Genomic DNA. No translation available.
    AC022404 Genomic DNA. No translation available.
    AC018513 Genomic DNA. No translation available.
    BC045834 mRNA. Translation: AAH45834.2 .
    BC150610 mRNA. Translation: AAI50611.1 .
    AK056756 mRNA. Translation: BAB71273.1 . Different initiation.
    AK125925 mRNA. No translation available.
    CCDSi CCDS32130.1. [Q6ZU80-2 ]
    RefSeqi NP_689659.2. NM_152446.3. [Q6ZU80-2 ]
    XP_006720119.1. XM_006720056.1. [Q6ZU80-2 ]
    UniGenei Hs.162889.

    3D structure databases

    ProteinModelPortali Q6ZU80.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 126920. 1 interaction.
    IntActi Q6ZU80. 2 interactions.
    STRINGi 9606.ENSP00000281129.

    PTM databases

    PhosphoSitei Q6ZU80.

    Polymorphism databases

    DMDMi 166214932.

    Proteomic databases

    MaxQBi Q6ZU80.
    PaxDbi Q6ZU80.
    PRIDEi Q6ZU80.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000216517 ; ENSP00000216517 ; ENSG00000100629 . [Q6ZU80-3 ]
    ENST00000281129 ; ENSP00000281129 ; ENSG00000100629 . [Q6ZU80-2 ]
    ENST00000555265 ; ENSP00000451162 ; ENSG00000100629 . [Q6ZU80-2 ]
    GeneIDi 145508.
    KEGGi hsa:145508.
    UCSCi uc001xux.2. human. [Q6ZU80-2 ]

    Organism-specific databases

    CTDi 145508.
    GeneCardsi GC14M080963.
    H-InvDB HIX0011861.
    HGNCi HGNC:20359. CEP128.
    HPAi HPA000602.
    HPA001116.
    HPA018498.
    neXtProti NX_Q6ZU80.
    PharmGKBi PA142672283.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG27482.
    HOVERGENi HBG106663.
    InParanoidi Q6ZU80.
    KOi K16460.
    OMAi RVQLNFN.
    PhylomeDBi Q6ZU80.
    TreeFami TF331714.

    Miscellaneous databases

    ChiTaRSi CEP128. human.
    GenomeRNAii 145508.
    NextBioi 85130.
    PROi Q6ZU80.

    Gene expression databases

    ArrayExpressi Q6ZU80.
    Bgeei Q6ZU80.
    CleanExi HS_C14orf145.
    Genevestigatori Q6ZU80.

    Family and domain databases

    InterProi IPR026652. CEP128.
    [Graphical view ]
    PANTHERi PTHR18937:SF149. PTHR18937:SF149. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The DNA sequence and analysis of human chromosome 14."
      Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
      , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
      Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Testis.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 310-1094 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 715-1094 (ISOFORM 1).
      Tissue: Placenta and Testis.
    4. "Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods."
      Jakobsen L., Vanselow K., Skogs M., Toyoda Y., Lundberg E., Poser I., Falkenby L.G., Bennetzen M., Westendorf J., Nigg E.A., Uhlen M., Hyman A.A., Andersen J.S.
      EMBO J. 30:1520-1535(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiCE128_HUMAN
    AccessioniPrimary (citable) accession number: Q6ZU80
    Secondary accession number(s): B9EK52, Q86X97, Q96ML4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2005
    Last sequence update: January 15, 2008
    Last modified: October 1, 2014
    This is version 83 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations

    External Data

    Dasty 3