Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 128 kDa

Gene

CEP128

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Centrosomal protein of 128 kDa
Short name:
Cep128
Gene namesi
Name:CEP128
Synonyms:C14orf145, C14orf61
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:20359. CEP128.

Subcellular locationi

GO - Cellular componenti

  • centriole Source: UniProtKB
  • cytoplasm Source: HPA
  • microtubule organizing center Source: HPA
  • spindle pole Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672283.

Polymorphism and mutation databases

BioMutaiCEP128.
DMDMi166214932.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10941094Centrosomal protein of 128 kDaPRO_0000089946Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei331 – 3311Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6ZU80.
PaxDbiQ6ZU80.
PRIDEiQ6ZU80.

PTM databases

PhosphoSiteiQ6ZU80.

Expressioni

Gene expression databases

BgeeiQ6ZU80.
CleanExiHS_C14orf145.
ExpressionAtlasiQ6ZU80. baseline and differential.
GenevestigatoriQ6ZU80.

Organism-specific databases

HPAiHPA000602.
HPA001116.
HPA018498.

Interactioni

Protein-protein interaction databases

BioGridi126920. 4 interactions.
IntActiQ6ZU80. 2 interactions.
STRINGi9606.ENSP00000281129.

Structurei

3D structure databases

ProteinModelPortaliQ6ZU80.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili190 – 827638Sequence AnalysisAdd
BLAST
Coiled coili879 – 95981Sequence AnalysisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG27482.
GeneTreeiENSGT00390000007020.
HOVERGENiHBG106663.
InParanoidiQ6ZU80.
KOiK16460.
OMAiQHQVSQI.
PhylomeDBiQ6ZU80.
TreeFamiTF331714.

Family and domain databases

InterProiIPR026652. CEP128.
[Graphical view]
PANTHERiPTHR18937:SF149. PTHR18937:SF149. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q6ZU80-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAESSSESDH FRCRDRLSPW AARSTHRGTR SLPTVEVTEK VNTITSTLQD
60 70 80 90 100
TSRNLRQVDQ MLGRYREYSN GQAGAIEHLK ESLEQSIDQL RSQRLLRNSG
110 120 130 140 150
GRSISVTSLS ASDLDGGTGS ELHHFPPTSP LKDYGDPQGI KRMRSRTGVR
160 170 180 190 200
FVQETDDMTQ LHGFHQSLRD LSSEQIRLGD DFNRELSRRS RSDAETKRAL
210 220 230 240 250
EELTEKLNEA QKQEVVSDRV ERRLQELERE MRTERELVER RQDQLGLMSL
260 270 280 290 300
QLQEALKKQE AKADEHEGAI KNKLRQTETE KNQLEQELEL SRRLLNQSEG
310 320 330 340 350
SRETLLHQVE ELRTQLTKAE GDRKGLQHQV SQISKQQSNY QDEQGEDWRF
360 370 380 390 400
RRGVEREKQD LEKQMSDLRV QLNFSAMASE LEEVKRCMER KDKEKAHLAS
410 420 430 440 450
QVENLTRELE NGEKQQLQML DRLKEIQNHF DTCEAERKHA DLQISELTRH
460 470 480 490 500
AEDATKQAER YLSELQQSEA LKEEAEKRRE DLKLKAQESI RQWKLKHKKL
510 520 530 540 550
ERALEKQSET VDELTGKNNQ ILKEKDELKT QLYAALQQIE NLRKELNDVL
560 570 580 590 600
TKRALQEEEL HSKEEKLRDI KSHQADLELE VKNSLDTIHR LESELKKQSK
610 620 630 640 650
IQSQMKVEKA HLEEEIAELK KSQAQDKAKL LEMQESIKDL SAIRADLANK
660 670 680 690 700
LAEEERAKKA VLKDLSDLTA QAKSRDEETA TIITQLKLER DVHQRELKDL
710 720 730 740 750
TSSLQSVKTK HEQNIQELMK HFKKEKSEAE NHIRTLKAES LEEKNMAKIH
760 770 780 790 800
RGQLEKLKSQ CDRLTEELTQ NENENKKLKL KYQCLKDQLE EREKHISIEE
810 820 830 840 850
EHLRRMEEAR LQLKDQLLCL ETEQESILGV IGKEIDAACK TFSKDSVEKL
860 870 880 890 900
KVFSSGPDIH YDPHRWLAES KTKLQWLCEE LKERENREKN LRHQLMLCRQ
910 920 930 940 950
QLRNLTENKE SELQCLFQQI ERQEQLLDEI HREKRDLLEE TQRKDEEMGS
960 970 980 990 1000
LQDRVIALET STQVALDHLE SVPEKLSLLE DFKDFRDSCS SSERTDGRYS
1010 1020 1030 1040 1050
KYRVRRNSLQ HHQDDTKYRT KSFKGDRTFL EGSHTRGLDH SSSWQDHSRF
1060 1070 1080 1090
LSSPRFSYVN SFTKRTVAPD SASNKEDATM NGTSSQPKKE EYGS
Length:1,094
Mass (Da):128,015
Last modified:January 15, 2008 - v2
Checksum:iBDE05923E3F6B0FF
GO
Isoform 1 (identifier: Q6ZU80-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     987-987: D → R
     988-1094: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:987
Mass (Da):115,784
Checksum:i94F4A1CDF521E942
GO
Isoform 3 (identifier: Q6ZU80-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     404-435: NLTRELENGEKQQLQMLDRLKEIQNHFDTCEA → HINRKCLLNLVQDLDCKDNEILTYSLQSPLHV
     436-1094: Missing.

Note: No experimental confirmation available.

Show »
Length:435
Mass (Da):50,469
Checksum:i62BE596D8FED35E0
GO

Sequence cautioni

The sequence BAB71273.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti395 – 3951K → R in AAH45834 (PubMed:15489334).Curated
Sequence conflicti973 – 9731P → A in BAB71273 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti16 – 161R → L.
Corresponds to variant rs7160694 [ dbSNP | Ensembl ].
VAR_037835
Natural varianti732 – 7321H → R.
Corresponds to variant rs327463 [ dbSNP | Ensembl ].
VAR_037836

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei404 – 43532NLTRE…DTCEA → HINRKCLLNLVQDLDCKDNE ILTYSLQSPLHV in isoform 3. 1 PublicationVSP_030194Add
BLAST
Alternative sequencei436 – 1094659Missing in isoform 3. 1 PublicationVSP_030195Add
BLAST
Alternative sequencei987 – 9871D → R in isoform 1. 1 PublicationVSP_014752
Alternative sequencei988 – 1094107Missing in isoform 1. 1 PublicationVSP_030196Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC010072 Genomic DNA. No translation available.
AC022404 Genomic DNA. No translation available.
AC018513 Genomic DNA. No translation available.
BC045834 mRNA. Translation: AAH45834.2.
BC150610 mRNA. Translation: AAI50611.1.
AK056756 mRNA. Translation: BAB71273.1. Different initiation.
AK125925 mRNA. No translation available.
CCDSiCCDS32130.1. [Q6ZU80-2]
RefSeqiNP_689659.2. NM_152446.3. [Q6ZU80-2]
XP_006720119.1. XM_006720056.2. [Q6ZU80-2]
UniGeneiHs.162889.

Genome annotation databases

EnsembliENST00000216517; ENSP00000216517; ENSG00000100629. [Q6ZU80-3]
ENST00000281129; ENSP00000281129; ENSG00000100629. [Q6ZU80-2]
ENST00000555265; ENSP00000451162; ENSG00000100629. [Q6ZU80-2]
GeneIDi145508.
KEGGihsa:145508.
UCSCiuc001xux.2. human. [Q6ZU80-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC010072 Genomic DNA. No translation available.
AC022404 Genomic DNA. No translation available.
AC018513 Genomic DNA. No translation available.
BC045834 mRNA. Translation: AAH45834.2.
BC150610 mRNA. Translation: AAI50611.1.
AK056756 mRNA. Translation: BAB71273.1. Different initiation.
AK125925 mRNA. No translation available.
CCDSiCCDS32130.1. [Q6ZU80-2]
RefSeqiNP_689659.2. NM_152446.3. [Q6ZU80-2]
XP_006720119.1. XM_006720056.2. [Q6ZU80-2]
UniGeneiHs.162889.

3D structure databases

ProteinModelPortaliQ6ZU80.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126920. 4 interactions.
IntActiQ6ZU80. 2 interactions.
STRINGi9606.ENSP00000281129.

PTM databases

PhosphoSiteiQ6ZU80.

Polymorphism and mutation databases

BioMutaiCEP128.
DMDMi166214932.

Proteomic databases

MaxQBiQ6ZU80.
PaxDbiQ6ZU80.
PRIDEiQ6ZU80.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000216517; ENSP00000216517; ENSG00000100629. [Q6ZU80-3]
ENST00000281129; ENSP00000281129; ENSG00000100629. [Q6ZU80-2]
ENST00000555265; ENSP00000451162; ENSG00000100629. [Q6ZU80-2]
GeneIDi145508.
KEGGihsa:145508.
UCSCiuc001xux.2. human. [Q6ZU80-2]

Organism-specific databases

CTDi145508.
GeneCardsiGC14M080963.
H-InvDBHIX0011861.
HGNCiHGNC:20359. CEP128.
HPAiHPA000602.
HPA001116.
HPA018498.
neXtProtiNX_Q6ZU80.
PharmGKBiPA142672283.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG27482.
GeneTreeiENSGT00390000007020.
HOVERGENiHBG106663.
InParanoidiQ6ZU80.
KOiK16460.
OMAiQHQVSQI.
PhylomeDBiQ6ZU80.
TreeFamiTF331714.

Miscellaneous databases

ChiTaRSiCEP128. human.
GenomeRNAii145508.
NextBioi85130.
PROiQ6ZU80.

Gene expression databases

BgeeiQ6ZU80.
CleanExiHS_C14orf145.
ExpressionAtlasiQ6ZU80. baseline and differential.
GenevestigatoriQ6ZU80.

Family and domain databases

InterProiIPR026652. CEP128.
[Graphical view]
PANTHERiPTHR18937:SF149. PTHR18937:SF149. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 310-1094 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 715-1094 (ISOFORM 1).
    Tissue: Placenta and Testis.
  4. "Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods."
    Jakobsen L., Vanselow K., Skogs M., Toyoda Y., Lundberg E., Poser I., Falkenby L.G., Bennetzen M., Westendorf J., Nigg E.A., Uhlen M., Hyman A.A., Andersen J.S.
    EMBO J. 30:1520-1535(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
  5. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-331, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiCE128_HUMAN
AccessioniPrimary (citable) accession number: Q6ZU80
Secondary accession number(s): B9EK52, Q86X97, Q96ML4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: January 15, 2008
Last modified: April 29, 2015
This is version 87 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.