Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6ZU80 (CE128_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 82. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Centrosomal protein of 128 kDa

Short name=Cep128
Gene names
Name:CEP128
Synonyms:C14orf145, C14orf61
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1094 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole. Cytoplasmcytoskeletonspindle pole. Note: Associates with the mother centriole. Ref.4

Sequence caution

The sequence BAB71273.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Keywords
   Cellular componentCytoplasm
Cytoskeleton
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcentriole

Inferred from direct assay Ref.4. Source: UniProtKB

cytoplasm

Inferred from direct assay. Source: HPA

microtubule organizing center

Inferred from direct assay. Source: HPA

spindle pole

Inferred from direct assay Ref.4. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 2 (identifier: Q6ZU80-2)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 (identifier: Q6ZU80-1)

The sequence of this isoform differs from the canonical sequence as follows:
     987-987: D → R
     988-1094: Missing.
Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 3 (identifier: Q6ZU80-3)

The sequence of this isoform differs from the canonical sequence as follows:
     404-435: NLTRELENGEKQQLQMLDRLKEIQNHFDTCEA → HINRKCLLNLVQDLDCKDNEILTYSLQSPLHV
     436-1094: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10941094Centrosomal protein of 128 kDa
PRO_0000089946

Regions

Coiled coil190 – 827638 Potential
Coiled coil879 – 95981 Potential

Natural variations

Alternative sequence404 – 43532NLTRE…DTCEA → HINRKCLLNLVQDLDCKDNE ILTYSLQSPLHV in isoform 3.
VSP_030194
Alternative sequence436 – 1094659Missing in isoform 3.
VSP_030195
Alternative sequence9871D → R in isoform 1.
VSP_014752
Alternative sequence988 – 1094107Missing in isoform 1.
VSP_030196
Natural variant161R → L.
Corresponds to variant rs7160694 [ dbSNP | Ensembl ].
VAR_037835
Natural variant7321H → R.
Corresponds to variant rs327463 [ dbSNP | Ensembl ].
VAR_037836

Experimental info

Sequence conflict3951K → R in AAH45834. Ref.2
Sequence conflict9731P → A in BAB71273. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 2 [UniParc].

Last modified January 15, 2008. Version 2.
Checksum: BDE05923E3F6B0FF

FASTA1,094128,015
        10         20         30         40         50         60 
MAESSSESDH FRCRDRLSPW AARSTHRGTR SLPTVEVTEK VNTITSTLQD TSRNLRQVDQ 

        70         80         90        100        110        120 
MLGRYREYSN GQAGAIEHLK ESLEQSIDQL RSQRLLRNSG GRSISVTSLS ASDLDGGTGS 

       130        140        150        160        170        180 
ELHHFPPTSP LKDYGDPQGI KRMRSRTGVR FVQETDDMTQ LHGFHQSLRD LSSEQIRLGD 

       190        200        210        220        230        240 
DFNRELSRRS RSDAETKRAL EELTEKLNEA QKQEVVSDRV ERRLQELERE MRTERELVER 

       250        260        270        280        290        300 
RQDQLGLMSL QLQEALKKQE AKADEHEGAI KNKLRQTETE KNQLEQELEL SRRLLNQSEG 

       310        320        330        340        350        360 
SRETLLHQVE ELRTQLTKAE GDRKGLQHQV SQISKQQSNY QDEQGEDWRF RRGVEREKQD 

       370        380        390        400        410        420 
LEKQMSDLRV QLNFSAMASE LEEVKRCMER KDKEKAHLAS QVENLTRELE NGEKQQLQML 

       430        440        450        460        470        480 
DRLKEIQNHF DTCEAERKHA DLQISELTRH AEDATKQAER YLSELQQSEA LKEEAEKRRE 

       490        500        510        520        530        540 
DLKLKAQESI RQWKLKHKKL ERALEKQSET VDELTGKNNQ ILKEKDELKT QLYAALQQIE 

       550        560        570        580        590        600 
NLRKELNDVL TKRALQEEEL HSKEEKLRDI KSHQADLELE VKNSLDTIHR LESELKKQSK 

       610        620        630        640        650        660 
IQSQMKVEKA HLEEEIAELK KSQAQDKAKL LEMQESIKDL SAIRADLANK LAEEERAKKA 

       670        680        690        700        710        720 
VLKDLSDLTA QAKSRDEETA TIITQLKLER DVHQRELKDL TSSLQSVKTK HEQNIQELMK 

       730        740        750        760        770        780 
HFKKEKSEAE NHIRTLKAES LEEKNMAKIH RGQLEKLKSQ CDRLTEELTQ NENENKKLKL 

       790        800        810        820        830        840 
KYQCLKDQLE EREKHISIEE EHLRRMEEAR LQLKDQLLCL ETEQESILGV IGKEIDAACK 

       850        860        870        880        890        900 
TFSKDSVEKL KVFSSGPDIH YDPHRWLAES KTKLQWLCEE LKERENREKN LRHQLMLCRQ 

       910        920        930        940        950        960 
QLRNLTENKE SELQCLFQQI ERQEQLLDEI HREKRDLLEE TQRKDEEMGS LQDRVIALET 

       970        980        990       1000       1010       1020 
STQVALDHLE SVPEKLSLLE DFKDFRDSCS SSERTDGRYS KYRVRRNSLQ HHQDDTKYRT 

      1030       1040       1050       1060       1070       1080 
KSFKGDRTFL EGSHTRGLDH SSSWQDHSRF LSSPRFSYVN SFTKRTVAPD SASNKEDATM 

      1090 
NGTSSQPKKE EYGS 

« Hide

Isoform 1 [UniParc].

Checksum: 94F4A1CDF521E942
Show »

FASTA987115,784
Isoform 3 [UniParc].

Checksum: 62BE596D8FED35E0
Show »

FASTA43550,469

References

« Hide 'large scale' references
[1]"The DNA sequence and analysis of human chromosome 14."
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. expand/collapse author list , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Testis.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 310-1094 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 715-1094 (ISOFORM 1).
Tissue: Placenta and Testis.
[4]"Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods."
Jakobsen L., Vanselow K., Skogs M., Toyoda Y., Lundberg E., Poser I., Falkenby L.G., Bennetzen M., Westendorf J., Nigg E.A., Uhlen M., Hyman A.A., Andersen J.S.
EMBO J. 30:1520-1535(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC010072 Genomic DNA. No translation available.
AC022404 Genomic DNA. No translation available.
AC018513 Genomic DNA. No translation available.
BC045834 mRNA. Translation: AAH45834.2.
BC150610 mRNA. Translation: AAI50611.1.
AK056756 mRNA. Translation: BAB71273.1. Different initiation.
AK125925 mRNA. No translation available.
CCDSCCDS32130.1. [Q6ZU80-2]
RefSeqNP_689659.2. NM_152446.3. [Q6ZU80-2]
XP_006720119.1. XM_006720056.1. [Q6ZU80-2]
UniGeneHs.162889.

3D structure databases

ProteinModelPortalQ6ZU80.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid126920. 1 interaction.
IntActQ6ZU80. 2 interactions.
STRING9606.ENSP00000281129.

PTM databases

PhosphoSiteQ6ZU80.

Polymorphism databases

DMDM166214932.

Proteomic databases

MaxQBQ6ZU80.
PaxDbQ6ZU80.
PRIDEQ6ZU80.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000216517; ENSP00000216517; ENSG00000100629. [Q6ZU80-3]
ENST00000281129; ENSP00000281129; ENSG00000100629. [Q6ZU80-2]
ENST00000555265; ENSP00000451162; ENSG00000100629. [Q6ZU80-2]
GeneID145508.
KEGGhsa:145508.
UCSCuc001xux.2. human. [Q6ZU80-2]

Organism-specific databases

CTD145508.
GeneCardsGC14M080963.
H-InvDBHIX0011861.
HGNCHGNC:20359. CEP128.
HPAHPA000602.
HPA001116.
HPA018498.
neXtProtNX_Q6ZU80.
PharmGKBPA142672283.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG27482.
HOVERGENHBG106663.
InParanoidQ6ZU80.
KOK16460.
OMARVQLNFN.
PhylomeDBQ6ZU80.
TreeFamTF331714.

Gene expression databases

ArrayExpressQ6ZU80.
BgeeQ6ZU80.
CleanExHS_C14orf145.
GenevestigatorQ6ZU80.

Family and domain databases

InterProIPR026652. CEP128.
[Graphical view]
PANTHERPTHR18937:SF149. PTHR18937:SF149. 1 hit.
ProtoNetSearch...

Other

ChiTaRSCEP128. human.
GenomeRNAi145508.
NextBio85130.
PROQ6ZU80.

Entry information

Entry nameCE128_HUMAN
AccessionPrimary (citable) accession number: Q6ZU80
Secondary accession number(s): B9EK52, Q86X97, Q96ML4
Entry history
Integrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: January 15, 2008
Last modified: July 9, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM