Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 108

Gene

CCDC108

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 108
Gene namesi
Name:CCDC108
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:25325. CCDC108.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei188 – 20821HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145008681.

Polymorphism and mutation databases

DMDMi148841209.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 19251925Coiled-coil domain-containing protein 108PRO_0000288805Add
BLAST

Proteomic databases

PaxDbiQ6ZU64.
PRIDEiQ6ZU64.

PTM databases

iPTMnetiQ6ZU64.
PhosphoSiteiQ6ZU64.

Expressioni

Gene expression databases

BgeeiQ6ZU64.
CleanExiHS_CCDC108.
ExpressionAtlasiQ6ZU64. baseline and differential.
GenevisibleiQ6ZU64. HS.

Organism-specific databases

HPAiHPA055156.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CCNDBP1O952733EBI-10255250,EBI-748961

Protein-protein interaction databases

BioGridi129075. 2 interactions.
IntActiQ6ZU64. 1 interaction.
STRINGi9606.ENSP00000340776.

Structurei

3D structure databases

ProteinModelPortaliQ6ZU64.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini877 – 986110MSPPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1525 – 155026Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1761 – 184888Glu-richAdd
BLAST

Sequence similaritiesi

Contains 1 MSP domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IFKT. Eukaryota.
ENOG410XPY3. LUCA.
GeneTreeiENSGT00430000031142.
HOGENOMiHOG000111378.
HOVERGENiHBG107148.
InParanoidiQ6ZU64.
OMAiPPRQIYE.
OrthoDBiEOG7MH0XC.
PhylomeDBiQ6ZU64.
TreeFamiTF329056.

Family and domain databases

InterProiIPR000535. MSP_dom.
[Graphical view]
PROSITEiPS50202. MSP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZU64-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFTLTGCRLV EKTQKVENPS VSFASSFPLI PLLLRGKSVQ KKQAESKSQI
60 70 80 90 100
KLHTQSAPFG LCPKDMMLTQ APSSVVRSRN SRNHTVNSGG SCLSASTVAI
110 120 130 140 150
PAINDSSAAM SACSTISAQP ASSMDTQMHS PKKQERVNKR VIWGIEVAEE
160 170 180 190 200
LHWKGWELGK ETTRNLVLKN RSLKLQKMKY RPPKTKFFFT VIPQPIFLSP
210 220 230 240 250
GITLTLPIVF RPLEAKEYMD QLWFEKAEGM FCVGLRATLP CHRLICRPPS
260 270 280 290 300
LQLPMCAVGD TTEAFFCLDN VGDLPTFFTW EFSSPFQMLP ATGLLEPGQA
310 320 330 340 350
SQIKVTFQPL TAVIYEVQAT CWYGAGSRQR SSIQLQAVAK CAQLLVSIKH
360 370 380 390 400
KCPEDQDAEG FQKLLYFGSV AVGCTSERQI RLHNPSAVNA PFRIEISPDE
410 420 430 440 450
LAEDQAFSCP TAHGIVLPGE KKCVSVFFHP KTLDTRTVDY CSIMPSGCAS
460 470 480 490 500
KTLLKVVGFC RGPAVSLQHY CVNFSWVNLG ERSEQPLWIE NQSDCTAHFQ
510 520 530 540 550
FAIDCLESVF TIRPAFGTLV GKARMTLHCA FQPTHPIICF RRVACLIHHQ
560 570 580 590 600
DPLFLDLMGT CHSDSTKPAI LKPQHLTWYR THLARGLTLY PPDILDAMLK
610 620 630 640 650
EKKLAQDQNG ALMIPIQDLE DMPAPQYPYI PPMTEFFFDG TSDITIFPPP
660 670 680 690 700
ISVEPVEVDF GACPGPEAPN PVPLCLMNHT KGKIMVVWTR RSDCPFWVTP
710 720 730 740 750
ESCDVPPLKS MAMRLHFQPP HPNCLYTVEL EAFAIYKVLQ SYSNIEEDCT
760 770 780 790 800
MCPSWCLTVR ARGHSYFAGF EHHIPQYSLD VPKLFPAVSS GEPTYRSLLL
810 820 830 840 850
VNKDCKLLTF SLAPQRGSDV ILRPTSGLVA PGAHQIILIC TYPEGSSWKQ
860 870 880 890 900
HTFYLQCNAS PQYLKEVSMY SREEPLQLKL DTHKSLYFKP TWVGCSSTSP
910 920 930 940 950
FTFRNPSRLP LQFEWRVSEQ HRKLLAVQPS RGLIQPNERL TLTWTFSPLE
960 970 980 990 1000
ETKYLFQVGM WVWEAGLSPN ANPAATTHYM LRLVGVGLTS SLSAKEKELA
1010 1020 1030 1040 1050
FGNVLVNSKQ SRFLVLLNDG NCTLYYRLYL EQGSPEAVDN HPLALQLDRT
1060 1070 1080 1090 1100
EGSMPPRSQD TICLTACPKQ RSQYSWTITY SLLSHRDNKA GEKQELCCVS
1110 1120 1130 1140 1150
LVAVYPLLSI LDVSSMGSAE GITRKHLWRL FSLDLLNSYL ERDPTPCELT
1160 1170 1180 1190 1200
YKVPTRHSMS QIPPVLTPLR LDFNFGAAPF KAPPSVVFLA LKNSGVVSLD
1210 1220 1230 1240 1250
WAFLLPSDQR IDVELWAEQA ELNSTELHQM RVQDNCLFSI SPKAGSLSPG
1260 1270 1280 1290 1300
QEQMVELKYS HLFIGTDHLP VLFKVSHGRE ILLNFIGVTV KPEQKYVHFT
1310 1320 1330 1340 1350
STTHQFIPIP IGDTLPPRQI YELYNGGSVP VTYEVQTDVL SQVQEKNFDH
1360 1370 1380 1390 1400
PIFCCLNPKG EIQPGSTARV LWIFSPIEAK TYTVDVPIHI LGWNSALIHF
1410 1420 1430 1440 1450
QGVGYNPHMM GDTAPFHNIS SWDNSSIHSR LVVPGQNVFL SQSHISLGNI
1460 1470 1480 1490 1500
PVQSKCSRLL FLNNISKNEE IAFSWQPSPL DFGEVSVSPM IGVVAPEETV
1510 1520 1530 1540 1550
PFVVTLRASV HASFYSADLV CKLYSQQLMR QYHKELQEWK DEKVRQEVEF
1560 1570 1580 1590 1600
TITDMKVKKR TCCTACEPAR KYKTLPPIKN QQSVSRPASW KLQTPKEEVS
1610 1620 1630 1640 1650
WPCPQPPSPG MLCLGLTARA HATDYFLANF FSEFPCHFLH RELPKRKAPR
1660 1670 1680 1690 1700
EESETSEEKS PNKWGPVSKQ KKQLLVDILT TIIRGLLEDK NFHEAVDQSL
1710 1720 1730 1740 1750
VEQVPYFRQF WNEQSTKFMD QKNSLYLMPI LPVPSSSWED GKGKQPKEDR
1760 1770 1780 1790 1800
PEHYPGLGKK EEGEEEKGEE EEEELEEEEE EEEETEEEEL GKEEIEEKEE
1810 1820 1830 1840 1850
ERDEKEEKVS WAGIGPTPQP ESQESMQWQW QQQLNVMVKE EQEQDEKEAI
1860 1870 1880 1890 1900
RRLPAFANLQ EALLENMIQN ILVEASRGEV VLTSRPRVIA LPPFCVPRSL
1910 1920
TPDTLLPTQQ AEVLHPVVPL PTDLP
Length:1,925
Mass (Da):217,250
Last modified:May 29, 2007 - v2
Checksum:i000CFE2B83394B42
GO
Isoform 2 (identifier: Q6ZU64-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.
     182-229: PPKTKFFFTV...DQLWFEKAEG → YQYKGSRTQC...SECLKYVQYE
     230-1925: Missing.

Note: No experimental confirmation available.
Show »
Length:164
Mass (Da):18,571
Checksum:iE61DB5602ADD73C2
GO
Isoform 3 (identifier: Q6ZU64-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.
     739-795: LQSYSNIEED...PAVSSGEPTY → CARNEREECG...MSLSPPKLLA
     796-1925: Missing.

Note: No experimental confirmation available.
Show »
Length:730
Mass (Da):81,378
Checksum:iF42999BD58A1ACC8
GO
Isoform 4 (identifier: Q6ZU64-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MFTLTGCRLVEKTQKVENPSVSFASSFPLIPLLL → METAIWRRSYISLISSERPVHNW
     739-795: LQSYSNIEED...PAVSSGEPTY → CARNEREECG...MSLSPPKLLA
     796-1925: Missing.

Note: No experimental confirmation available.
Show »
Length:784
Mass (Da):87,601
Checksum:i15CFF1980112F460
GO

Sequence cautioni

The sequence BAC86362.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC86878.1 differs from that shown.Unlikely isoform. Aberrant splice sites.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti129 – 1291H → R in BAC86878 (PubMed:14702039).Curated
Sequence conflicti320 – 3201T → A in BAC86878 (PubMed:14702039).Curated
Sequence conflicti665 – 6651G → W in BAC86878 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti66 – 661M → L.2 Publications
Corresponds to variant rs6736922 [ dbSNP | Ensembl ].
VAR_032500
Natural varianti672 – 6721V → I.
Corresponds to variant rs13403802 [ dbSNP | Ensembl ].
VAR_050726
Natural varianti806 – 8061K → M.
Corresponds to variant rs9653262 [ dbSNP | Ensembl ].
VAR_050727
Natural varianti1858 – 18581N → S.
Corresponds to variant rs11893183 [ dbSNP | Ensembl ].
VAR_050728

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6565Missing in isoform 2 and isoform 3. 1 PublicationVSP_045221Add
BLAST
Alternative sequencei1 – 3434MFTLT…IPLLL → METAIWRRSYISLISSERPV HNW in isoform 4. CuratedVSP_055631Add
BLAST
Alternative sequencei182 – 22948PPKTK…EKAEG → YQYKGSRTQCHSLEPRKQAL FKTKQNKQKKPLTCHIKASE CLKYVQYE in isoform 2. 1 PublicationVSP_045222Add
BLAST
Alternative sequencei230 – 19251696Missing in isoform 2. 1 PublicationVSP_045223Add
BLAST
Alternative sequencei739 – 79557LQSYS…GEPTY → CARNEREECGVSARSLSGLV GWQEVTEGSFRLHPLRARLS LGWTVTPMSLSPPKLLA in isoform 3 and isoform 4. CuratedVSP_055632Add
BLAST
Alternative sequencei796 – 19251130Missing in isoform 3 and isoform 4. CuratedVSP_055633Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125957 mRNA. Translation: BAC86362.1. Different initiation.
AK127189 mRNA. Translation: BAC86878.1. Sequence problems.
AC097468 Genomic DNA. No translation available.
BC031585 mRNA. Translation: AAH31585.1.
BC130281 mRNA. Translation: AAI30282.1.
AL833882 mRNA. Translation: CAD38738.1.
CCDSiCCDS2430.2. [Q6ZU64-1]
CCDS2431.2. [Q6ZU64-3]
CCDS63125.1. [Q6ZU64-4]
CCDS63126.1. [Q6ZU64-5]
RefSeqiNP_689602.2. NM_152389.3. [Q6ZU64-3]
NP_919278.2. NM_194302.3. [Q6ZU64-1]
XP_011509212.1. XM_011510910.1.
UniGeneiHs.147762.

Genome annotation databases

EnsembliENST00000295729; ENSP00000295729; ENSG00000181378. [Q6ZU64-3]
ENST00000341552; ENSP00000340776; ENSG00000181378. [Q6ZU64-1]
ENST00000409865; ENSP00000386945; ENSG00000181378. [Q6ZU64-5]
ENST00000410037; ENSP00000386258; ENSG00000181378. [Q6ZU64-4]
ENST00000453220; ENSP00000409117; ENSG00000181378. [Q6ZU64-1]
GeneIDi255101.
UCSCiuc002vjl.3. human. [Q6ZU64-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125957 mRNA. Translation: BAC86362.1. Different initiation.
AK127189 mRNA. Translation: BAC86878.1. Sequence problems.
AC097468 Genomic DNA. No translation available.
BC031585 mRNA. Translation: AAH31585.1.
BC130281 mRNA. Translation: AAI30282.1.
AL833882 mRNA. Translation: CAD38738.1.
CCDSiCCDS2430.2. [Q6ZU64-1]
CCDS2431.2. [Q6ZU64-3]
CCDS63125.1. [Q6ZU64-4]
CCDS63126.1. [Q6ZU64-5]
RefSeqiNP_689602.2. NM_152389.3. [Q6ZU64-3]
NP_919278.2. NM_194302.3. [Q6ZU64-1]
XP_011509212.1. XM_011510910.1.
UniGeneiHs.147762.

3D structure databases

ProteinModelPortaliQ6ZU64.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129075. 2 interactions.
IntActiQ6ZU64. 1 interaction.
STRINGi9606.ENSP00000340776.

PTM databases

iPTMnetiQ6ZU64.
PhosphoSiteiQ6ZU64.

Polymorphism and mutation databases

DMDMi148841209.

Proteomic databases

PaxDbiQ6ZU64.
PRIDEiQ6ZU64.

Protocols and materials databases

DNASUi255101.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000295729; ENSP00000295729; ENSG00000181378. [Q6ZU64-3]
ENST00000341552; ENSP00000340776; ENSG00000181378. [Q6ZU64-1]
ENST00000409865; ENSP00000386945; ENSG00000181378. [Q6ZU64-5]
ENST00000410037; ENSP00000386258; ENSG00000181378. [Q6ZU64-4]
ENST00000453220; ENSP00000409117; ENSG00000181378. [Q6ZU64-1]
GeneIDi255101.
UCSCiuc002vjl.3. human. [Q6ZU64-1]

Organism-specific databases

CTDi255101.
GeneCardsiCCDC108.
H-InvDBHIX0002843.
HIX0002845.
HGNCiHGNC:25325. CCDC108.
HPAiHPA055156.
neXtProtiNX_Q6ZU64.
PharmGKBiPA145008681.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFKT. Eukaryota.
ENOG410XPY3. LUCA.
GeneTreeiENSGT00430000031142.
HOGENOMiHOG000111378.
HOVERGENiHBG107148.
InParanoidiQ6ZU64.
OMAiPPRQIYE.
OrthoDBiEOG7MH0XC.
PhylomeDBiQ6ZU64.
TreeFamiTF329056.

Miscellaneous databases

GenomeRNAii255101.
NextBioi35501912.
PROiQ6ZU64.

Gene expression databases

BgeeiQ6ZU64.
CleanExiHS_CCDC108.
ExpressionAtlasiQ6ZU64. baseline and differential.
GenevisibleiQ6ZU64. HS.

Family and domain databases

InterProiIPR000535. MSP_dom.
[Graphical view]
PROSITEiPS50202. MSP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-66.
    Tissue: Testis.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 704-1925 (ISOFORM 1), VARIANT LEU-66.
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 821-1215 (ISOFORM 1).
    Tissue: Testis.

Entry informationi

Entry nameiCC108_HUMAN
AccessioniPrimary (citable) accession number: Q6ZU64
Secondary accession number(s): A2BDD8
, E9PCR1, E9PG25, E9PG72, Q6ZSR8, Q8N0T4, Q8NDJ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: March 16, 2016
This is version 98 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.