Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative EP400-like protein

Gene

EP400P1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Protein uncertaini

Functioni

Caution

Could be the product of a pseudogene.Curated

Names & Taxonomyi

Protein namesi
Recommended name:
Putative EP400-like proteinCurated
Alternative name(s):
EP400 pseudogene 1Imported
Gene namesi
Name:EP400P1Imported
Synonyms:EP400NLImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

EuPathDBiHostDB:ENSG00000185684.12
HGNCiHGNC:26602 EP400P1
neXtProtiNX_Q6ZTU2

Pathology & Biotechi

Polymorphism and mutation databases

DMDMi166922146

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003149491 – 488Putative EP400-like proteinAdd BLAST488

Proteomic databases

MaxQBiQ6ZTU2
PaxDbiQ6ZTU2
PeptideAtlasiQ6ZTU2
PRIDEiQ6ZTU2

PTM databases

iPTMnetiQ6ZTU2
PhosphoSitePlusiQ6ZTU2

Expressioni

Gene expression databases

BgeeiENSG00000185684
CleanExiHS_EP400NL
GenevisibleiQ6ZTU2 HS

Organism-specific databases

HPAiHPA068417

Interactioni

Protein-protein interaction databases

IntActiQ6ZTU2, 1 interactor
STRINGi9606.ENSP00000365812

Structurei

3D structure databases

ProteinModelPortaliQ6ZTU2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiKOG0391 Eukaryota
COG0553 LUCA
InParanoidiQ6ZTU2
OMAiKVVARKH
PhylomeDBiQ6ZTU2
TreeFamiTF342061

Family and domain databases

InterProiView protein in InterPro
IPR031575 EP400_N
PfamiView protein in Pfam
PF15790 EP400_N, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZTU2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQHVSSSQSS QRHVQWPGAC PGAGEEQPAC SQPSLPLTLP SPSHQLQQLM
60 70 80 90 100
VRGGPAGGQN MNVDLQGVGP GLQGSPQVTL APLPLPSPTS PGFQFSAQPR
110 120 130 140 150
RFEHGSPSYI QVTSPLSQQV QTQSPTQPSP GPGQALQNVR AGAPGPGLGL
160 170 180 190 200
CSSSPTGDFV DASVLVRQIS LSPSSGGHFV FQDGSGLTQI AQGAQVQLQH
210 220 230 240 250
PGTPITVRER RPSQPHTQSG GTIHHLGPQS PAAAGGAGLQ PLASPSHITT
260 270 280 290 300
ANLPPQISSI IQGQLVQQQQ VLQGPPLPRP LGFERTPGVL LPGAGGAAGF
310 320 330 340 350
GMTSPPPPTS PSRTAVPPGL SSLPLTSVGN TGMKKVPKKL EEIPPASPEM
360 370 380 390 400
AQMRKQCLDY HHQEMQALKE VFKEYLIELF FLQHFQGNMM DFLAFKERLY
410 420 430 440 450
GPLQAYLRQN DLDIEEEEEE HFEVINDEVK VVARKHGQPG TPVAIATQLP
460 470 480
PRTSAAFPAQ QQPLQQIHMG TPVPGDVNSI KMEASKRQ
Note: No experimental confirmation available.
Length:488
Mass (Da):51,753
Last modified:February 5, 2008 - v2
Checksum:i97A94BCED9AF8B54
GO
Isoform 2 (identifier: Q6ZTU2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-118: Missing.
     466-488: QIHMGTPVPGDVNSIKMEASKRQ → PLAPTTVLSVSADWNALLQRPNKYIWGLQYLEM

Show »
Length:430
Mass (Da):46,039
Checksum:i4983EFB6A210D161
GO
Isoform 3 (identifier: Q6ZTU2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-182: Missing.
     254-274: Missing.
     466-488: QIHMGTPVPGDVNSIKMEASKRQ → PLAPTTVLSVSADWNALLQRPNKYIWGLQYLEM

Note: No experimental confirmation available.
Show »
Length:345
Mass (Da):37,382
Checksum:i0DCFEDBF68BC7702
GO
Isoform 4 (identifier: Q6ZTU2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-182: Missing.
     466-488: QIHMGTPVPGDVNSIKMEASKRQ → VLSDGSTVQLPRLSSLGFEDSMC

Show »
Length:356
Mass (Da):38,305
Checksum:i19B7178F5F3F0F5F
GO
Isoform 5 (identifier: Q6ZTU2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     466-488: QIHMGTPVPGDVNSIKMEASKRQ → VLSDGSTVQLPRLSSLGFEDSMC

Show »
Length:488
Mass (Da):51,670
Checksum:iF8410F81DBD71045
GO

Sequence cautioni

The sequence CAB56026 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti179F → L in BAC86487 (PubMed:14702039).Curated1
Sequence conflicti244S → G in BAC03617 (PubMed:14702039).Curated1
Sequence conflicti442P → S in BAC86487 (PubMed:14702039).Curated1
Sequence conflicti452R → W in BAC03617 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03044251 – 182Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST132
Alternative sequenceiVSP_03044351 – 118Missing in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_030445254 – 274Missing in isoform 3. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_030446466 – 488QIHMG…ASKRQ → PLAPTTVLSVSADWNALLQR PNKYIWGLQYLEM in isoform 2 and isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_030447466 – 488QIHMG…ASKRQ → VLSDGSTVQLPRLSSLGFED SMC in isoform 4 and isoform 5. 2 PublicationsAdd BLAST23

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090610 mRNA Translation: BAG52194.1
AK091234 mRNA Translation: BAC03617.1
AK097720 mRNA Translation: BAC05150.1
AK126212 mRNA Translation: BAC86487.1
AK289710 mRNA Translation: BAF82399.1
AC138466 Genomic DNA No translation available.
AL117637 mRNA Translation: CAB56026.2 Different initiation.
PIRiT17336
UniGeneiHs.122115

Genome annotation databases

UCSCiuc001ujt.3 human [Q6ZTU2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiE400N_HUMAN
AccessioniPrimary (citable) accession number: Q6ZTU2
Secondary accession number(s): A6NLB7
, A8K0Z5, B3KQY2, Q6NXP1, Q8N253, Q8N7S7, Q9UFJ3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: May 23, 2018
This is version 83 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health