Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

EP400 N-terminal-like protein

Gene

EP400NL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
EP400 N-terminal-like protein
Gene namesi
Name:EP400NL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:26602. EP400NL.

Pathology & Biotechi

Polymorphism and mutation databases

DMDMi166922146.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 488488EP400 N-terminal-like proteinPRO_0000314949Add
BLAST

Proteomic databases

EPDiQ6ZTU2.
MaxQBiQ6ZTU2.
PaxDbiQ6ZTU2.
PeptideAtlasiQ6ZTU2.
PRIDEiQ6ZTU2.

PTM databases

iPTMnetiQ6ZTU2.
PhosphoSiteiQ6ZTU2.

Expressioni

Gene expression databases

BgeeiENSG00000185684.
CleanExiHS_EP400NL.
ExpressionAtlasiQ6ZTU2. baseline and differential.
GenevisibleiQ6ZTU2. HS.

Organism-specific databases

HPAiHPA068417.

Interactioni

Protein-protein interaction databases

IntActiQ6ZTU2. 1 interaction.
STRINGi9606.ENSP00000365812.

Structurei

3D structure databases

ProteinModelPortaliQ6ZTU2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiKOG0391. Eukaryota.
COG0553. LUCA.
GeneTreeiENSGT00530000063427.
InParanoidiQ6ZTU2.
OMAiKVVARKH.
PhylomeDBiQ6ZTU2.
TreeFamiTF342061.

Family and domain databases

InterProiIPR031575. EP400_N.
[Graphical view]
PfamiPF15790. EP400_N. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZTU2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQHVSSSQSS QRHVQWPGAC PGAGEEQPAC SQPSLPLTLP SPSHQLQQLM
60 70 80 90 100
VRGGPAGGQN MNVDLQGVGP GLQGSPQVTL APLPLPSPTS PGFQFSAQPR
110 120 130 140 150
RFEHGSPSYI QVTSPLSQQV QTQSPTQPSP GPGQALQNVR AGAPGPGLGL
160 170 180 190 200
CSSSPTGDFV DASVLVRQIS LSPSSGGHFV FQDGSGLTQI AQGAQVQLQH
210 220 230 240 250
PGTPITVRER RPSQPHTQSG GTIHHLGPQS PAAAGGAGLQ PLASPSHITT
260 270 280 290 300
ANLPPQISSI IQGQLVQQQQ VLQGPPLPRP LGFERTPGVL LPGAGGAAGF
310 320 330 340 350
GMTSPPPPTS PSRTAVPPGL SSLPLTSVGN TGMKKVPKKL EEIPPASPEM
360 370 380 390 400
AQMRKQCLDY HHQEMQALKE VFKEYLIELF FLQHFQGNMM DFLAFKERLY
410 420 430 440 450
GPLQAYLRQN DLDIEEEEEE HFEVINDEVK VVARKHGQPG TPVAIATQLP
460 470 480
PRTSAAFPAQ QQPLQQIHMG TPVPGDVNSI KMEASKRQ
Note: No experimental confirmation available.
Length:488
Mass (Da):51,753
Last modified:February 5, 2008 - v2
Checksum:i97A94BCED9AF8B54
GO
Isoform 2 (identifier: Q6ZTU2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-118: Missing.
     466-488: QIHMGTPVPGDVNSIKMEASKRQ → PLAPTTVLSVSADWNALLQRPNKYIWGLQYLEM

Show »
Length:430
Mass (Da):46,039
Checksum:i4983EFB6A210D161
GO
Isoform 3 (identifier: Q6ZTU2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-182: Missing.
     254-274: Missing.
     466-488: QIHMGTPVPGDVNSIKMEASKRQ → PLAPTTVLSVSADWNALLQRPNKYIWGLQYLEM

Note: No experimental confirmation available.
Show »
Length:345
Mass (Da):37,382
Checksum:i0DCFEDBF68BC7702
GO
Isoform 4 (identifier: Q6ZTU2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-182: Missing.
     466-488: QIHMGTPVPGDVNSIKMEASKRQ → VLSDGSTVQLPRLSSLGFEDSMC

Show »
Length:356
Mass (Da):38,305
Checksum:i19B7178F5F3F0F5F
GO
Isoform 5 (identifier: Q6ZTU2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     466-488: QIHMGTPVPGDVNSIKMEASKRQ → VLSDGSTVQLPRLSSLGFEDSMC

Show »
Length:488
Mass (Da):51,670
Checksum:iF8410F81DBD71045
GO

Sequence cautioni

The sequence CAB56026 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti179 – 1791F → L in BAC86487 (PubMed:14702039).Curated
Sequence conflicti244 – 2441S → G in BAC03617 (PubMed:14702039).Curated
Sequence conflicti442 – 4421P → S in BAC86487 (PubMed:14702039).Curated
Sequence conflicti452 – 4521R → W in BAC03617 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei51 – 182132Missing in isoform 3 and isoform 4. 1 PublicationVSP_030442Add
BLAST
Alternative sequencei51 – 11868Missing in isoform 2. 1 PublicationVSP_030443Add
BLAST
Alternative sequencei254 – 27421Missing in isoform 3. 1 PublicationVSP_030445Add
BLAST
Alternative sequencei466 – 48823QIHMG…ASKRQ → PLAPTTVLSVSADWNALLQR PNKYIWGLQYLEM in isoform 2 and isoform 3. 1 PublicationVSP_030446Add
BLAST
Alternative sequencei466 – 48823QIHMG…ASKRQ → VLSDGSTVQLPRLSSLGFED SMC in isoform 4 and isoform 5. 2 PublicationsVSP_030447Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090610 mRNA. Translation: BAG52194.1.
AK091234 mRNA. Translation: BAC03617.1.
AK097720 mRNA. Translation: BAC05150.1.
AK126212 mRNA. Translation: BAC86487.1.
AK289710 mRNA. Translation: BAF82399.1.
AC138466 Genomic DNA. No translation available.
AL117637 mRNA. Translation: CAB56026.2. Different initiation.
PIRiT17336.
UniGeneiHs.122115.

Genome annotation databases

EnsembliENST00000332441; ENSP00000328997; ENSG00000185684. [Q6ZTU2-2]
ENST00000392352; ENSP00000376163; ENSG00000185684. [Q6ZTU2-5]
ENST00000443539; ENSP00000404338; ENSG00000185684. [Q6ZTU2-5]
ENST00000446190; ENSP00000396499; ENSG00000185684. [Q6ZTU2-1]
UCSCiuc001ujt.3. human. [Q6ZTU2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090610 mRNA. Translation: BAG52194.1.
AK091234 mRNA. Translation: BAC03617.1.
AK097720 mRNA. Translation: BAC05150.1.
AK126212 mRNA. Translation: BAC86487.1.
AK289710 mRNA. Translation: BAF82399.1.
AC138466 Genomic DNA. No translation available.
AL117637 mRNA. Translation: CAB56026.2. Different initiation.
PIRiT17336.
UniGeneiHs.122115.

3D structure databases

ProteinModelPortaliQ6ZTU2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ6ZTU2. 1 interaction.
STRINGi9606.ENSP00000365812.

PTM databases

iPTMnetiQ6ZTU2.
PhosphoSiteiQ6ZTU2.

Polymorphism and mutation databases

DMDMi166922146.

Proteomic databases

EPDiQ6ZTU2.
MaxQBiQ6ZTU2.
PaxDbiQ6ZTU2.
PeptideAtlasiQ6ZTU2.
PRIDEiQ6ZTU2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000332441; ENSP00000328997; ENSG00000185684. [Q6ZTU2-2]
ENST00000392352; ENSP00000376163; ENSG00000185684. [Q6ZTU2-5]
ENST00000443539; ENSP00000404338; ENSG00000185684. [Q6ZTU2-5]
ENST00000446190; ENSP00000396499; ENSG00000185684. [Q6ZTU2-1]
UCSCiuc001ujt.3. human. [Q6ZTU2-1]

Organism-specific databases

GeneCardsiEP400NL.
HGNCiHGNC:26602. EP400NL.
HPAiHPA068417.
neXtProtiNX_Q6ZTU2.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0391. Eukaryota.
COG0553. LUCA.
GeneTreeiENSGT00530000063427.
InParanoidiQ6ZTU2.
OMAiKVVARKH.
PhylomeDBiQ6ZTU2.
TreeFamiTF342061.

Miscellaneous databases

ChiTaRSiEP400NL. human.
PROiQ6ZTU2.

Gene expression databases

BgeeiENSG00000185684.
CleanExiHS_EP400NL.
ExpressionAtlasiQ6ZTU2. baseline and differential.
GenevisibleiQ6ZTU2. HS.

Family and domain databases

InterProiIPR031575. EP400_N.
[Graphical view]
PfamiPF15790. EP400_N. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiE400N_HUMAN
AccessioniPrimary (citable) accession number: Q6ZTU2
Secondary accession number(s): A6NLB7
, A8K0Z5, B3KQY2, Q6NXP1, Q8N253, Q8N7S7, Q9UFJ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: September 7, 2016
This is version 73 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.