Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras association domain-containing protein 6

Gene

RASSF6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the induction of apoptosis, through both caspase-dependent and caspase-independent pathways. May act as a Ras effector protein. May suppress the serum-induced basal levels of NF-kappa-B (By similarity).By similarity1 Publication

GO - Biological processi

Keywordsi

Biological processApoptosis

Enzyme and pathway databases

SIGNORiQ6ZTQ3.

Names & Taxonomyi

Protein namesi
Recommended name:
Ras association domain-containing protein 6
Gene namesi
Name:RASSF6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000169435.13.
HGNCiHGNC:20796. RASSF6.

Pathology & Biotechi

Organism-specific databases

DisGeNETi166824.
OpenTargetsiENSG00000169435.
PharmGKBiPA134900075.

Polymorphism and mutation databases

BioMutaiRASSF6.
DMDMi74749658.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002404041 – 369Ras association domain-containing protein 6Add BLAST369

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei187PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ6ZTQ3.
PeptideAtlasiQ6ZTQ3.
PRIDEiQ6ZTQ3.

PTM databases

iPTMnetiQ6ZTQ3.
PhosphoSitePlusiQ6ZTQ3.

Expressioni

Tissue specificityi

Highest expression in thymus, kidney and placenta. Also detected in colon, small intestine and lung. Tends to be down-regulated in 30-60% of tumors derived from breast, colon, kidney liver, rectum, pancreas, stomach and the thyroid gland compared to the normal counterpart.1 Publication

Gene expression databases

BgeeiENSG00000169435.
CleanExiHS_RASSF6.
GenevisibleiQ6ZTQ3. HS.

Organism-specific databases

HPAiHPA037712.

Interactioni

Subunit structurei

Interacts with MOAP1 (By similarity). Interaction with activated KRAS is still a matter of debate: interaction has been shown in the mouse (PubMed:17404571), but not in human (PubMed:17367779). Lack of interaction with MRAS, NRAS nor RRAS2 has also been reported (PubMed:17367779).By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
STK4Q130434EBI-2933412,EBI-367376

Protein-protein interaction databases

BioGridi127936. 8 interactors.
IntActiQ6ZTQ3. 4 interactors.
STRINGi9606.ENSP00000340578.

Structurei

3D structure databases

ProteinModelPortaliQ6ZTQ3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini218 – 306Ras-associatingPROSITE-ProRule annotationAdd BLAST89
Domaini313 – 360SARAHPROSITE-ProRule annotationAdd BLAST48

Phylogenomic databases

eggNOGiENOG410IPAD. Eukaryota.
ENOG4111F26. LUCA.
GeneTreeiENSGT00510000046426.
HOGENOMiHOG000231738.
HOVERGENiHBG054302.
InParanoidiQ6ZTQ3.
KOiK09854.
OMAiKHRASIN.
OrthoDBiEOG091G0BOA.
PhylomeDBiQ6ZTQ3.
TreeFamiTF319243.

Family and domain databases

InterProiView protein in InterPro
IPR033614. C-RASSF.
IPR000159. RA_dom.
IPR033625. RASSF6.
IPR011524. SARAH_dom.
IPR029071. Ubiquitin-rel_dom.
PANTHERiPTHR22738. PTHR22738. 1 hit.
PTHR22738:SF23. PTHR22738:SF23. 1 hit.
PfamiView protein in Pfam
PF16517. Nore1-SARAH. 1 hit.
PF00788. RA. 1 hit.
SMARTiView protein in SMART
SM00314. RA. 1 hit.
SUPFAMiSSF54236. SSF54236. 1 hit.
PROSITEiView protein in PROSITE
PS50200. RA. 1 hit.
PS50951. SARAH. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZTQ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLWEETGAAP APARASDLPY RISSDHLKKE EKMTMMAHQY PSWIFINEKT
60 70 80 90 100
FITREQLNSL LKTYNIFYEN QKNLHILYGE TEDGKLIVEG MLDIFWGVKR
110 120 130 140 150
PIQLKIQDEK PFSSFTSMKS SDVFSSKGMT RWGEFDDLYR ISELDRTQIP
160 170 180 190 200
MSEKRNSQED YLSYHSNTLK PHAKDEPDSP VLYRTMSEAA LVRKRMKPLM
210 220 230 240 250
MDRKERQKNR ASINGHFYNH ETSIFIPAFE SETKVRVNSN MRTEEVIKQL
260 270 280 290 300
LQKFKIENSP QDFALHIIFA TGEQRRLKKT DIPLLQRLLQ GPSEKNARIF
310 320 330 340 350
LMDKDAEEIS SDVAQYINFH FSLLESILQR LNEEEKREIQ RIVTKFNKEK
360
AIILKCLQNK LVIKTETTV
Length:369
Mass (Da):43,384
Last modified:July 5, 2004 - v1
Checksum:i19AF7D4B1ABA5ED6
GO
Isoform 2 (identifier: Q6ZTQ3-2) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.

Show »
Length:337
Mass (Da):39,804
Checksum:i68D026FC687DFDD8
GO
Isoform 3 (identifier: Q6ZTQ3-3) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     23-80: SSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYENQKNLHILYGE → HFLSSGLILVTRQL

Show »
Length:325
Mass (Da):37,872
Checksum:i91C71FBC2E18D6D9
GO
Isoform 4 (identifier: Q6ZTQ3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     222-255: Missing.

Show »
Length:303
Mass (Da):35,809
Checksum:i7B4510499A52918E
GO

Sequence cautioni

The sequence AAH58835 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH18138 differs from that shown. Reason: Erroneous termination at position 148. Translated as Gln.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026725163S → P1 PublicationCorresponds to variant dbSNP:rs12507775Ensembl.1
Natural variantiVAR_034440306A → G. Corresponds to variant dbSNP:rs17804499Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0193701 – 32Missing in isoform 2 and isoform 4. 3 PublicationsAdd BLAST32
Alternative sequenceiVSP_01937123 – 80SSDHL…ILYGE → HFLSSGLILVTRQL in isoform 3. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_019372222 – 255Missing in isoform 4. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY217665 mRNA. Translation: AAO61690.1.
AY217664 mRNA. Translation: AAO61689.1.
AK126346 mRNA. Translation: BAC86530.1.
CR749283 mRNA. Translation: CAH18138.1. Sequence problems.
BC058835 mRNA. Translation: AAH58835.1. Different initiation.
CCDSiCCDS3558.1. [Q6ZTQ3-1]
CCDS3559.1. [Q6ZTQ3-2]
CCDS58904.1. [Q6ZTQ3-4]
CCDS58905.1. [Q6ZTQ3-3]
RefSeqiNP_001257320.1. NM_001270391.1. [Q6ZTQ3-4]
NP_001257321.1. NM_001270392.1. [Q6ZTQ3-3]
NP_803876.1. NM_177532.4. [Q6ZTQ3-2]
NP_958834.1. NM_201431.2. [Q6ZTQ3-1]
XP_011529990.1. XM_011531688.1. [Q6ZTQ3-2]
UniGeneiHs.529677.

Genome annotation databases

EnsembliENST00000307439; ENSP00000303877; ENSG00000169435. [Q6ZTQ3-2]
ENST00000335049; ENSP00000335582; ENSG00000169435. [Q6ZTQ3-3]
ENST00000342081; ENSP00000340578; ENSG00000169435. [Q6ZTQ3-1]
ENST00000395777; ENSP00000379123; ENSG00000169435. [Q6ZTQ3-4]
GeneIDi166824.
KEGGihsa:166824.
UCSCiuc003hhc.3. human. [Q6ZTQ3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiRASF6_HUMAN
AccessioniPrimary (citable) accession number: Q6ZTQ3
Secondary accession number(s): Q68DT2
, Q6PDA6, Q86WG9, Q86WH0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 5, 2004
Last modified: September 27, 2017
This is version 113 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot