Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6ZTQ3 (RASF6_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 87. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ras association domain-containing protein 6
Gene names
Name:RASSF6
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length369 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Involved in the induction of apoptosis, through both caspase-dependent and caspase-independent pathways. May act as a Ras effector protein. May suppress the serum-induced basal levels of NF-kappa-B By similarity. Ref.5

Subunit structure

Interacts with MOAP1 By similarity. Interaction with activated KRAS is still a matter of debate: interaction has been shown in the mouse (Ref.6), but not in human (Ref.5). Lack of interaction with MRAS, NRAS nor RRAS2 has also been reported (Ref.5). Ref.5

Tissue specificity

Highest expression in thymus, kidney and placenta. Also detected in colon, small intestine and lung. Tends to be down-regulated in 30-60% of tumors derived from breast, colon, kidney liver, rectum, pancreas, stomach and the thyroid gland compared to the normal counterpart. Ref.6

Sequence similarities

Contains 1 Ras-associating domain.

Contains 1 SARAH domain.

Sequence caution

The sequence AAH58835.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAH18138.1 differs from that shown. Reason: Erroneous termination at position 148. Translated as Gln.

Ontologies

Binary interactions

With

Entry

#Exp.

IntAct

Notes

STK4Q130434EBI-2933412,EBI-367376

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6ZTQ3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6ZTQ3-2)

Also known as: A;

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
Isoform 3 (identifier: Q6ZTQ3-3)

Also known as: B;

The sequence of this isoform differs from the canonical sequence as follows:
     23-80: SSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYENQKNLHILYGE → HFLSSGLILVTRQL
Isoform 4 (identifier: Q6ZTQ3-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     222-255: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 369369Ras association domain-containing protein 6
PRO_0000240404

Regions

Domain218 – 30689Ras-associating
Domain313 – 36048SARAH

Natural variations

Alternative sequence1 – 3232Missing in isoform 2 and isoform 4.
VSP_019370
Alternative sequence23 – 8058SSDHL…ILYGE → HFLSSGLILVTRQL in isoform 3.
VSP_019371
Alternative sequence222 – 25534Missing in isoform 4.
VSP_019372
Natural variant1631S → P. Ref.4
Corresponds to variant rs12507775 [ dbSNP | Ensembl ].
VAR_026725
Natural variant3061A → G.
Corresponds to variant rs17804499 [ dbSNP | Ensembl ].
VAR_034440

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 19AF7D4B1ABA5ED6

FASTA36943,384
        10         20         30         40         50         60 
MLWEETGAAP APARASDLPY RISSDHLKKE EKMTMMAHQY PSWIFINEKT FITREQLNSL 

        70         80         90        100        110        120 
LKTYNIFYEN QKNLHILYGE TEDGKLIVEG MLDIFWGVKR PIQLKIQDEK PFSSFTSMKS 

       130        140        150        160        170        180 
SDVFSSKGMT RWGEFDDLYR ISELDRTQIP MSEKRNSQED YLSYHSNTLK PHAKDEPDSP 

       190        200        210        220        230        240 
VLYRTMSEAA LVRKRMKPLM MDRKERQKNR ASINGHFYNH ETSIFIPAFE SETKVRVNSN 

       250        260        270        280        290        300 
MRTEEVIKQL LQKFKIENSP QDFALHIIFA TGEQRRLKKT DIPLLQRLLQ GPSEKNARIF 

       310        320        330        340        350        360 
LMDKDAEEIS SDVAQYINFH FSLLESILQR LNEEEKREIQ RIVTKFNKEK AIILKCLQNK 


LVIKTETTV 

« Hide

Isoform 2 (A) [UniParc].

Checksum: 68D026FC687DFDD8
Show »

FASTA33739,804
Isoform 3 (B) [UniParc].

Checksum: 91C71FBC2E18D6D9
Show »

FASTA32537,872
Isoform 4 [UniParc].

Checksum: 7B4510499A52918E
Show »

FASTA30335,809

References

« Hide 'large scale' references
[1]"RASSF6, a member of the RASSF family of putative tumor suppressors, is transcriptionally repressed in lung and breast cancers."
Burbee D.G., White M.A., Miller D.S., Minna J.D., Muller C.Y.
Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Trachea.
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Small intestine.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT PRO-163.
Tissue: Prostate.
[5]"Ras-association domain family protein 6 induces apoptosis via both caspase-dependent and caspase-independent pathways."
Ikeda M., Hirabayashi S., Fujiwara N., Mori H., Kawata A., Iida J., Bao Y., Sato Y., Iida T., Sugimura H., Hata Y.
Exp. Cell Res. 313:1484-1495(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, LACK OF INTERACTION WITH KRAS; MRAS; NRAS AND RRAS2.
[6]"RASSF6 is a novel member of the RASSF family of tumor suppressors."
Allen N.P., Donninger H., Vos M.D., Eckfeld K., Hesson L., Gordon L., Birrer M.J., Latif F., Clark G.J.
Oncogene 26:6203-6211(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY217665 mRNA. Translation: AAO61690.1.
AY217664 mRNA. Translation: AAO61689.1.
AK126346 mRNA. Translation: BAC86530.1.
CR749283 mRNA. Translation: CAH18138.1. Sequence problems.
BC058835 mRNA. Translation: AAH58835.1. Different initiation.
RefSeqNP_001257320.1. NM_001270391.1.
NP_001257321.1. NM_001270392.1.
NP_803876.1. NM_177532.4.
NP_958834.1. NM_201431.2.
UniGeneHs.529677.

3D structure databases

ProteinModelPortalQ6ZTQ3.
SMRQ6ZTQ3. Positions 222-304, 318-345.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127936. 5 interactions.
IntActQ6ZTQ3. 3 interactions.
STRING9606.ENSP00000340578.

PTM databases

PhosphoSiteQ6ZTQ3.

Polymorphism databases

DMDM74749658.

Proteomic databases

PaxDbQ6ZTQ3.
PRIDEQ6ZTQ3.

Protocols and materials databases

DNASU166824.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000307439; ENSP00000303877; ENSG00000169435. [Q6ZTQ3-2]
ENST00000335049; ENSP00000335582; ENSG00000169435. [Q6ZTQ3-3]
ENST00000342081; ENSP00000340578; ENSG00000169435. [Q6ZTQ3-1]
ENST00000395777; ENSP00000379123; ENSG00000169435. [Q6ZTQ3-4]
GeneID166824.
KEGGhsa:166824.
UCSCuc003hhc.2. human. [Q6ZTQ3-1]
uc010iik.2. human. [Q6ZTQ3-4]
uc010iil.2. human. [Q6ZTQ3-3]

Organism-specific databases

CTD166824.
GeneCardsGC04M074437.
HGNCHGNC:20796. RASSF6.
HPAHPA037711.
MIM612620. gene.
neXtProtNX_Q6ZTQ3.
PharmGKBPA134900075.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG244901.
HOGENOMHOG000231738.
HOVERGENHBG054302.
InParanoidQ6ZTQ3.
KOK09854.
OMAKHRASIN.
OrthoDBEOG7DVDBF.
PhylomeDBQ6ZTQ3.
TreeFamTF319243.

Gene expression databases

BgeeQ6ZTQ3.
CleanExHS_RASSF6.
GenevestigatorQ6ZTQ3.

Family and domain databases

InterProIPR000159. Ras-assoc.
IPR011524. SARAH_dom.
[Graphical view]
PfamPF00788. RA. 1 hit.
[Graphical view]
SMARTSM00314. RA. 1 hit.
[Graphical view]
PROSITEPS50200. RA. 1 hit.
PS50951. SARAH. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi166824.
NextBio88631.
PROQ6ZTQ3.
SOURCESearch...

Entry information

Entry nameRASF6_HUMAN
AccessionPrimary (citable) accession number: Q6ZTQ3
Secondary accession number(s): Q68DT2 expand/collapse secondary AC list , Q6PDA6, Q86WG9, Q86WH0
Entry history
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 5, 2004
Last modified: March 19, 2014
This is version 87 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM