Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6ZTQ3

- RASF6_HUMAN

UniProt

Q6ZTQ3 - RASF6_HUMAN

Protein

Ras association domain-containing protein 6

Gene

RASSF6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 91 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in the induction of apoptosis, through both caspase-dependent and caspase-independent pathways. May act as a Ras effector protein. May suppress the serum-induced basal levels of NF-kappa-B By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. positive regulation of apoptotic process Source: Ensembl
    3. signal transduction Source: InterPro

    Keywords - Biological processi

    Apoptosis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ras association domain-containing protein 6
    Gene namesi
    Name:RASSF6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:20796. RASSF6.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134900075.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 369369Ras association domain-containing protein 6PRO_0000240404Add
    BLAST

    Proteomic databases

    PaxDbiQ6ZTQ3.
    PRIDEiQ6ZTQ3.

    PTM databases

    PhosphoSiteiQ6ZTQ3.

    Expressioni

    Tissue specificityi

    Highest expression in thymus, kidney and placenta. Also detected in colon, small intestine and lung. Tends to be down-regulated in 30-60% of tumors derived from breast, colon, kidney liver, rectum, pancreas, stomach and the thyroid gland compared to the normal counterpart.1 Publication

    Gene expression databases

    BgeeiQ6ZTQ3.
    CleanExiHS_RASSF6.
    GenevestigatoriQ6ZTQ3.

    Organism-specific databases

    HPAiHPA037711.

    Interactioni

    Subunit structurei

    Interacts with MOAP1 By similarity. Interaction with activated KRAS is still a matter of debate: interaction has been shown in the mouse (PubMed:17404571), but not in human (PubMed:17367779). Lack of interaction with MRAS, NRAS nor RRAS2 has also been reported (PubMed:17367779).By similarity2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    STK4Q130434EBI-2933412,EBI-367376

    Protein-protein interaction databases

    BioGridi127936. 5 interactions.
    IntActiQ6ZTQ3. 3 interactions.
    STRINGi9606.ENSP00000340578.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6ZTQ3.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini218 – 30689Ras-associatingPROSITE-ProRule annotationAdd
    BLAST
    Domaini313 – 36048SARAHPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 Ras-associating domain.PROSITE-ProRule annotation
    Contains 1 SARAH domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG244901.
    HOGENOMiHOG000231738.
    HOVERGENiHBG054302.
    InParanoidiQ6ZTQ3.
    KOiK09854.
    OMAiKHRASIN.
    OrthoDBiEOG7DVDBF.
    PhylomeDBiQ6ZTQ3.
    TreeFamiTF319243.

    Family and domain databases

    InterProiIPR000159. Ras-assoc.
    IPR011524. SARAH_dom.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view]
    PfamiPF00788. RA. 1 hit.
    [Graphical view]
    SMARTiSM00314. RA. 1 hit.
    [Graphical view]
    SUPFAMiSSF54236. SSF54236. 1 hit.
    PROSITEiPS50200. RA. 1 hit.
    PS50951. SARAH. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6ZTQ3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLWEETGAAP APARASDLPY RISSDHLKKE EKMTMMAHQY PSWIFINEKT    50
    FITREQLNSL LKTYNIFYEN QKNLHILYGE TEDGKLIVEG MLDIFWGVKR 100
    PIQLKIQDEK PFSSFTSMKS SDVFSSKGMT RWGEFDDLYR ISELDRTQIP 150
    MSEKRNSQED YLSYHSNTLK PHAKDEPDSP VLYRTMSEAA LVRKRMKPLM 200
    MDRKERQKNR ASINGHFYNH ETSIFIPAFE SETKVRVNSN MRTEEVIKQL 250
    LQKFKIENSP QDFALHIIFA TGEQRRLKKT DIPLLQRLLQ GPSEKNARIF 300
    LMDKDAEEIS SDVAQYINFH FSLLESILQR LNEEEKREIQ RIVTKFNKEK 350
    AIILKCLQNK LVIKTETTV 369
    Length:369
    Mass (Da):43,384
    Last modified:July 5, 2004 - v1
    Checksum:i19AF7D4B1ABA5ED6
    GO
    Isoform 2 (identifier: Q6ZTQ3-2) [UniParc]FASTAAdd to Basket

    Also known as: A

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: Missing.

    Show »
    Length:337
    Mass (Da):39,804
    Checksum:i68D026FC687DFDD8
    GO
    Isoform 3 (identifier: Q6ZTQ3-3) [UniParc]FASTAAdd to Basket

    Also known as: B

    The sequence of this isoform differs from the canonical sequence as follows:
         23-80: SSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYENQKNLHILYGE → HFLSSGLILVTRQL

    Show »
    Length:325
    Mass (Da):37,872
    Checksum:i91C71FBC2E18D6D9
    GO
    Isoform 4 (identifier: Q6ZTQ3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: Missing.
         222-255: Missing.

    Show »
    Length:303
    Mass (Da):35,809
    Checksum:i7B4510499A52918E
    GO

    Sequence cautioni

    The sequence AAH58835.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAH18138.1 differs from that shown. Reason: Erroneous termination at position 148. Translated as Gln.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti163 – 1631S → P.1 Publication
    Corresponds to variant rs12507775 [ dbSNP | Ensembl ].
    VAR_026725
    Natural varianti306 – 3061A → G.
    Corresponds to variant rs17804499 [ dbSNP | Ensembl ].
    VAR_034440

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3232Missing in isoform 2 and isoform 4. 3 PublicationsVSP_019370Add
    BLAST
    Alternative sequencei23 – 8058SSDHL…ILYGE → HFLSSGLILVTRQL in isoform 3. 1 PublicationVSP_019371Add
    BLAST
    Alternative sequencei222 – 25534Missing in isoform 4. 1 PublicationVSP_019372Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY217665 mRNA. Translation: AAO61690.1.
    AY217664 mRNA. Translation: AAO61689.1.
    AK126346 mRNA. Translation: BAC86530.1.
    CR749283 mRNA. Translation: CAH18138.1. Sequence problems.
    BC058835 mRNA. Translation: AAH58835.1. Different initiation.
    CCDSiCCDS3558.1. [Q6ZTQ3-1]
    CCDS3559.1. [Q6ZTQ3-2]
    CCDS58904.1. [Q6ZTQ3-4]
    CCDS58905.1. [Q6ZTQ3-3]
    RefSeqiNP_001257320.1. NM_001270391.1. [Q6ZTQ3-4]
    NP_001257321.1. NM_001270392.1. [Q6ZTQ3-3]
    NP_803876.1. NM_177532.4. [Q6ZTQ3-2]
    NP_958834.1. NM_201431.2. [Q6ZTQ3-1]
    UniGeneiHs.529677.

    Genome annotation databases

    EnsembliENST00000307439; ENSP00000303877; ENSG00000169435. [Q6ZTQ3-2]
    ENST00000335049; ENSP00000335582; ENSG00000169435. [Q6ZTQ3-3]
    ENST00000342081; ENSP00000340578; ENSG00000169435. [Q6ZTQ3-1]
    ENST00000395777; ENSP00000379123; ENSG00000169435. [Q6ZTQ3-4]
    GeneIDi166824.
    KEGGihsa:166824.
    UCSCiuc003hhc.2. human. [Q6ZTQ3-1]
    uc010iik.2. human. [Q6ZTQ3-4]
    uc010iil.2. human. [Q6ZTQ3-3]

    Polymorphism databases

    DMDMi74749658.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY217665 mRNA. Translation: AAO61690.1 .
    AY217664 mRNA. Translation: AAO61689.1 .
    AK126346 mRNA. Translation: BAC86530.1 .
    CR749283 mRNA. Translation: CAH18138.1 . Sequence problems.
    BC058835 mRNA. Translation: AAH58835.1 . Different initiation.
    CCDSi CCDS3558.1. [Q6ZTQ3-1 ]
    CCDS3559.1. [Q6ZTQ3-2 ]
    CCDS58904.1. [Q6ZTQ3-4 ]
    CCDS58905.1. [Q6ZTQ3-3 ]
    RefSeqi NP_001257320.1. NM_001270391.1. [Q6ZTQ3-4 ]
    NP_001257321.1. NM_001270392.1. [Q6ZTQ3-3 ]
    NP_803876.1. NM_177532.4. [Q6ZTQ3-2 ]
    NP_958834.1. NM_201431.2. [Q6ZTQ3-1 ]
    UniGenei Hs.529677.

    3D structure databases

    ProteinModelPortali Q6ZTQ3.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127936. 5 interactions.
    IntActi Q6ZTQ3. 3 interactions.
    STRINGi 9606.ENSP00000340578.

    PTM databases

    PhosphoSitei Q6ZTQ3.

    Polymorphism databases

    DMDMi 74749658.

    Proteomic databases

    PaxDbi Q6ZTQ3.
    PRIDEi Q6ZTQ3.

    Protocols and materials databases

    DNASUi 166824.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000307439 ; ENSP00000303877 ; ENSG00000169435 . [Q6ZTQ3-2 ]
    ENST00000335049 ; ENSP00000335582 ; ENSG00000169435 . [Q6ZTQ3-3 ]
    ENST00000342081 ; ENSP00000340578 ; ENSG00000169435 . [Q6ZTQ3-1 ]
    ENST00000395777 ; ENSP00000379123 ; ENSG00000169435 . [Q6ZTQ3-4 ]
    GeneIDi 166824.
    KEGGi hsa:166824.
    UCSCi uc003hhc.2. human. [Q6ZTQ3-1 ]
    uc010iik.2. human. [Q6ZTQ3-4 ]
    uc010iil.2. human. [Q6ZTQ3-3 ]

    Organism-specific databases

    CTDi 166824.
    GeneCardsi GC04M074437.
    HGNCi HGNC:20796. RASSF6.
    HPAi HPA037711.
    MIMi 612620. gene.
    neXtProti NX_Q6ZTQ3.
    PharmGKBi PA134900075.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG244901.
    HOGENOMi HOG000231738.
    HOVERGENi HBG054302.
    InParanoidi Q6ZTQ3.
    KOi K09854.
    OMAi KHRASIN.
    OrthoDBi EOG7DVDBF.
    PhylomeDBi Q6ZTQ3.
    TreeFami TF319243.

    Miscellaneous databases

    GenomeRNAii 166824.
    NextBioi 88631.
    PROi Q6ZTQ3.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q6ZTQ3.
    CleanExi HS_RASSF6.
    Genevestigatori Q6ZTQ3.

    Family and domain databases

    InterProi IPR000159. Ras-assoc.
    IPR011524. SARAH_dom.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view ]
    Pfami PF00788. RA. 1 hit.
    [Graphical view ]
    SMARTi SM00314. RA. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54236. SSF54236. 1 hit.
    PROSITEi PS50200. RA. 1 hit.
    PS50951. SARAH. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "RASSF6, a member of the RASSF family of putative tumor suppressors, is transcriptionally repressed in lung and breast cancers."
      Burbee D.G., White M.A., Miller D.S., Minna J.D., Muller C.Y.
      Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Trachea.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Small intestine.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT PRO-163.
      Tissue: Prostate.
    5. "Ras-association domain family protein 6 induces apoptosis via both caspase-dependent and caspase-independent pathways."
      Ikeda M., Hirabayashi S., Fujiwara N., Mori H., Kawata A., Iida J., Bao Y., Sato Y., Iida T., Sugimura H., Hata Y.
      Exp. Cell Res. 313:1484-1495(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, LACK OF INTERACTION WITH KRAS; MRAS; NRAS AND RRAS2.
    6. "RASSF6 is a novel member of the RASSF family of tumor suppressors."
      Allen N.P., Donninger H., Vos M.D., Eckfeld K., Hesson L., Gordon L., Birrer M.J., Latif F., Clark G.J.
      Oncogene 26:6203-6211(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiRASF6_HUMAN
    AccessioniPrimary (citable) accession number: Q6ZTQ3
    Secondary accession number(s): Q68DT2
    , Q6PDA6, Q86WG9, Q86WH0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 27, 2006
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 91 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3