Q6ZTQ3 (RASF6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ras association domain-containing protein 6 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 369 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the induction of apoptosis, through both caspase-dependent and caspase-independent pathways. May act as a Ras effector protein. May suppress the serum-induced basal levels of NF-kappa-B By similarity. Ref.5 |
| Subunit structure | Interacts with MOAP1 By similarity. Interaction with activated KRAS is still a matter of debate: interaction has been shown in the mouse (Ref.6), but not in human (Ref.5). Lack of interaction with MRAS, NRAS nor RRAS2 has also been reported (Ref.5). Ref.5 |
| Tissue specificity | Highest expression in thymus, kidney and placenta. Also detected in colon, small intestine and lung. Tends to be down-regulated in 30-60% of tumors derived from breast, colon, kidney liver, rectum, pancreas, stomach and the thyroid gland compared to the normal counterpart. Ref.6 |
| Sequence similarities | Contains 1 Ras-associating domain. Contains 1 SARAH domain. |
| Sequence caution | The sequence AAH58835.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAH18138.1 differs from that shown. Reason: Erroneous termination at position 148. Translated as Gln. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | apoptotic process Inferred from electronic annotation. Source: UniProtKB-KW regulation of apoptotic processInferred from electronic annotation. Source: Compara signal transductionInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| STK4 | Q13043 | 2 | EBI-2933412,EBI-367376 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6ZTQ3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6ZTQ3-2) Also known as: A; The sequence of this isoform differs from the canonical sequence as follows: 1-32: Missing. | ||||||
| Isoform 3 (identifier: Q6ZTQ3-3) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 23-80: SSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYENQKNLHILYGE → HFLSSGLILVTRQL | ||||||
| Isoform 4 (identifier: Q6ZTQ3-4) The sequence of this isoform differs from the canonical sequence as follows: 1-32: Missing. 222-255: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 369 | 369 | Ras association domain-containing protein 6 | PRO_0000240404 | |||||
Regions | |||||||||
| Domain | 218 – 306 | 89 | Ras-associating | ||||||
| Domain | 313 – 360 | 48 | SARAH | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 32 | 32 | Missing in isoform 2 and isoform 4. | VSP_019370 | |||||
| Alternative sequence | 23 – 80 | 58 | SSDHL…ILYGE → HFLSSGLILVTRQL in isoform 3. | VSP_019371 | |||||
| Alternative sequence | 222 – 255 | 34 | Missing in isoform 4. | VSP_019372 | |||||
| Natural variant | 163 | 1 | S → P. Ref.4 Corresponds to variant rs12507775 [ dbSNP | Ensembl ]. | VAR_026725 | |||||
| Natural variant | 306 | 1 | A → G. Corresponds to variant rs17804499 [ dbSNP | Ensembl ]. | VAR_034440 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "RASSF6, a member of the RASSF family of putative tumor suppressors, is transcriptionally repressed in lung and breast cancers." Burbee D.G., White M.A., Miller D.S., Minna J.D., Muller C.Y. Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Trachea. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Small intestine. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT PRO-163. Tissue: Prostate. |
| [5] | "Ras-association domain family protein 6 induces apoptosis via both caspase-dependent and caspase-independent pathways." Ikeda M., Hirabayashi S., Fujiwara N., Mori H., Kawata A., Iida J., Bao Y., Sato Y., Iida T., Sugimura H., Hata Y. Exp. Cell Res. 313:1484-1495(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, LACK OF INTERACTION WITH KRAS; MRAS; NRAS AND RRAS2. |
| [6] | "RASSF6 is a novel member of the RASSF family of tumor suppressors." Allen N.P., Donninger H., Vos M.D., Eckfeld K., Hesson L., Gordon L., Birrer M.J., Latif F., Clark G.J. Oncogene 26:6203-6211(2007) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY217665 mRNA. Translation: AAO61690.1. AY217664 mRNA. Translation: AAO61689.1. AK126346 mRNA. Translation: BAC86530.1. CR749283 mRNA. Translation: CAH18138.1. Sequence problems. BC058835 mRNA. Translation: AAH58835.1. Different initiation. |
| IPI | IPI00176707. IPI00384451. IPI00398796. IPI00760776. |
| RefSeq | NP_001257320.1. NM_001270391.1. NP_001257321.1. NM_001270392.1. NP_803876.1. NM_177532.4. NP_958834.1. NM_201431.2. |
| UniGene | Hs.529677. |
3D structure databases | |
| ProteinModelPortal | Q6ZTQ3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6ZTQ3. 2 interactions. |
| STRING | 9606.ENSP00000340578. |
PTM databases | |
| PhosphoSite | Q6ZTQ3. |
Polymorphism databases | |
| DMDM | 74749658. |
Proteomic databases | |
| PaxDb | Q6ZTQ3. |
| PRIDE | Q6ZTQ3. |
Protocols and materials databases | |
| DNASU | 166824. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000307439; ENSP00000303877; ENSG00000169435. ENST00000335049; ENSP00000335582; ENSG00000169435. ENST00000342081; ENSP00000340578; ENSG00000169435. ENST00000395777; ENSP00000379123; ENSG00000169435. |
| GeneID | 166824. |
| KEGG | hsa:166824. |
| UCSC | uc003hhc.1. human. uc010iik.1. human. uc010iil.1. human. |
Organism-specific databases | |
| CTD | 166824. |
| GeneCards | GC04M074437. |
| HGNC | HGNC:20796. RASSF6. |
| HPA | HPA037711. |
| MIM | 612620. gene. |
| neXtProt | NX_Q6ZTQ3. |
| PharmGKB | PA134900075. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG244901. |
| HOGENOM | HOG000231738. |
| HOVERGEN | HBG054302. |
| InParanoid | Q6ZTQ3. |
| KO | K09854. |
| OMA | RGMTRWG. |
| OrthoDB | EOG49W2FK. |
| PhylomeDB | Q6ZTQ3. |
Gene expression databases | |
| Bgee | Q6ZTQ3. |
| CleanEx | HS_RASSF6. |
| Genevestigator | Q6ZTQ3. |
| GermOnline | ENSG00000169435. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000159. Ras-assoc. IPR011524. SARAH_dom. [Graphical view] |
| Pfam | PF00788. RA. 1 hit. [Graphical view] |
| SMART | SM00314. RA. 1 hit. [Graphical view] |
| PROSITE | PS50200. RA. 1 hit. PS50951. SARAH. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 166824. |
| NextBio | 88631. |
| SOURCE | Search... |
Entry information
| Entry name | RASF6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6ZTQ3 Secondary accession number(s): Q68DT2 Q86WH0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
