SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6ZTQ3

- RASF6_HUMAN

UniProt

Q6ZTQ3 - RASF6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ras association domain-containing protein 6
Gene
RASSF6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Involved in the induction of apoptosis, through both caspase-dependent and caspase-independent pathways. May act as a Ras effector protein. May suppress the serum-induced basal levels of NF-kappa-B By similarity.1 Publication

GO - Molecular functioni

  1. protein binding Source: IntAct
Complete GO annotation...

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. positive regulation of apoptotic process Source: Ensembl
  3. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Ras association domain-containing protein 6
Gene namesi
Name:RASSF6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:20796. RASSF6.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134900075.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 369369Ras association domain-containing protein 6
PRO_0000240404Add
BLAST

Proteomic databases

PaxDbiQ6ZTQ3.
PRIDEiQ6ZTQ3.

PTM databases

PhosphoSiteiQ6ZTQ3.

Expressioni

Tissue specificityi

Highest expression in thymus, kidney and placenta. Also detected in colon, small intestine and lung. Tends to be down-regulated in 30-60% of tumors derived from breast, colon, kidney liver, rectum, pancreas, stomach and the thyroid gland compared to the normal counterpart.1 Publication

Gene expression databases

BgeeiQ6ZTQ3.
CleanExiHS_RASSF6.
GenevestigatoriQ6ZTQ3.

Organism-specific databases

HPAiHPA037711.

Interactioni

Subunit structurei

Interacts with MOAP1 By similarity. Interaction with activated KRAS is still a matter of debate: interaction has been shown in the mouse (1 Publication), but not in human (1 Publication). Lack of interaction with MRAS, NRAS nor RRAS2 has also been reported (1 Publication).1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
STK4Q130434EBI-2933412,EBI-367376

Protein-protein interaction databases

BioGridi127936. 5 interactions.
IntActiQ6ZTQ3. 3 interactions.
STRINGi9606.ENSP00000340578.

Structurei

3D structure databases

ProteinModelPortaliQ6ZTQ3.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini218 – 30689Ras-associating
Add
BLAST
Domaini313 – 36048SARAH
Add
BLAST

Sequence similaritiesi

Contains 1 SARAH domain.

Phylogenomic databases

eggNOGiNOG244901.
HOGENOMiHOG000231738.
HOVERGENiHBG054302.
InParanoidiQ6ZTQ3.
KOiK09854.
OMAiKHRASIN.
OrthoDBiEOG7DVDBF.
PhylomeDBiQ6ZTQ3.
TreeFamiTF319243.

Family and domain databases

InterProiIPR000159. Ras-assoc.
IPR011524. SARAH_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF00788. RA. 1 hit.
[Graphical view]
SMARTiSM00314. RA. 1 hit.
[Graphical view]
SUPFAMiSSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS50951. SARAH. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6ZTQ3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLWEETGAAP APARASDLPY RISSDHLKKE EKMTMMAHQY PSWIFINEKT    50
FITREQLNSL LKTYNIFYEN QKNLHILYGE TEDGKLIVEG MLDIFWGVKR 100
PIQLKIQDEK PFSSFTSMKS SDVFSSKGMT RWGEFDDLYR ISELDRTQIP 150
MSEKRNSQED YLSYHSNTLK PHAKDEPDSP VLYRTMSEAA LVRKRMKPLM 200
MDRKERQKNR ASINGHFYNH ETSIFIPAFE SETKVRVNSN MRTEEVIKQL 250
LQKFKIENSP QDFALHIIFA TGEQRRLKKT DIPLLQRLLQ GPSEKNARIF 300
LMDKDAEEIS SDVAQYINFH FSLLESILQR LNEEEKREIQ RIVTKFNKEK 350
AIILKCLQNK LVIKTETTV 369
Length:369
Mass (Da):43,384
Last modified:July 5, 2004 - v1
Checksum:i19AF7D4B1ABA5ED6
GO
Isoform 2 (identifier: Q6ZTQ3-2) [UniParc]FASTAAdd to Basket

Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.

Show »
Length:337
Mass (Da):39,804
Checksum:i68D026FC687DFDD8
GO
Isoform 3 (identifier: Q6ZTQ3-3) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     23-80: SSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYENQKNLHILYGE → HFLSSGLILVTRQL

Show »
Length:325
Mass (Da):37,872
Checksum:i91C71FBC2E18D6D9
GO
Isoform 4 (identifier: Q6ZTQ3-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     222-255: Missing.

Show »
Length:303
Mass (Da):35,809
Checksum:i7B4510499A52918E
GO

Sequence cautioni

The sequence AAH58835.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAH18138.1 differs from that shown. Reason: Erroneous termination at position 148. Translated as Gln.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti163 – 1631S → P.1 Publication
Corresponds to variant rs12507775 [ dbSNP | Ensembl ].
VAR_026725
Natural varianti306 – 3061A → G.
Corresponds to variant rs17804499 [ dbSNP | Ensembl ].
VAR_034440

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232Missing in isoform 2 and isoform 4.
VSP_019370Add
BLAST
Alternative sequencei23 – 8058SSDHL…ILYGE → HFLSSGLILVTRQL in isoform 3.
VSP_019371Add
BLAST
Alternative sequencei222 – 25534Missing in isoform 4.
VSP_019372Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY217665 mRNA. Translation: AAO61690.1.
AY217664 mRNA. Translation: AAO61689.1.
AK126346 mRNA. Translation: BAC86530.1.
CR749283 mRNA. Translation: CAH18138.1. Sequence problems.
BC058835 mRNA. Translation: AAH58835.1. Different initiation.
CCDSiCCDS3558.1. [Q6ZTQ3-1]
CCDS3559.1. [Q6ZTQ3-2]
CCDS58904.1. [Q6ZTQ3-4]
CCDS58905.1. [Q6ZTQ3-3]
RefSeqiNP_001257320.1. NM_001270391.1. [Q6ZTQ3-4]
NP_001257321.1. NM_001270392.1. [Q6ZTQ3-3]
NP_803876.1. NM_177532.4. [Q6ZTQ3-2]
NP_958834.1. NM_201431.2. [Q6ZTQ3-1]
UniGeneiHs.529677.

Genome annotation databases

EnsembliENST00000307439; ENSP00000303877; ENSG00000169435. [Q6ZTQ3-2]
ENST00000335049; ENSP00000335582; ENSG00000169435. [Q6ZTQ3-3]
ENST00000342081; ENSP00000340578; ENSG00000169435. [Q6ZTQ3-1]
ENST00000395777; ENSP00000379123; ENSG00000169435. [Q6ZTQ3-4]
GeneIDi166824.
KEGGihsa:166824.
UCSCiuc003hhc.2. human. [Q6ZTQ3-1]
uc010iik.2. human. [Q6ZTQ3-4]
uc010iil.2. human. [Q6ZTQ3-3]

Polymorphism databases

DMDMi74749658.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY217665 mRNA. Translation: AAO61690.1 .
AY217664 mRNA. Translation: AAO61689.1 .
AK126346 mRNA. Translation: BAC86530.1 .
CR749283 mRNA. Translation: CAH18138.1 . Sequence problems.
BC058835 mRNA. Translation: AAH58835.1 . Different initiation.
CCDSi CCDS3558.1. [Q6ZTQ3-1 ]
CCDS3559.1. [Q6ZTQ3-2 ]
CCDS58904.1. [Q6ZTQ3-4 ]
CCDS58905.1. [Q6ZTQ3-3 ]
RefSeqi NP_001257320.1. NM_001270391.1. [Q6ZTQ3-4 ]
NP_001257321.1. NM_001270392.1. [Q6ZTQ3-3 ]
NP_803876.1. NM_177532.4. [Q6ZTQ3-2 ]
NP_958834.1. NM_201431.2. [Q6ZTQ3-1 ]
UniGenei Hs.529677.

3D structure databases

ProteinModelPortali Q6ZTQ3.
ModBasei Search...

Protein-protein interaction databases

BioGridi 127936. 5 interactions.
IntActi Q6ZTQ3. 3 interactions.
STRINGi 9606.ENSP00000340578.

PTM databases

PhosphoSitei Q6ZTQ3.

Polymorphism databases

DMDMi 74749658.

Proteomic databases

PaxDbi Q6ZTQ3.
PRIDEi Q6ZTQ3.

Protocols and materials databases

DNASUi 166824.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000307439 ; ENSP00000303877 ; ENSG00000169435 . [Q6ZTQ3-2 ]
ENST00000335049 ; ENSP00000335582 ; ENSG00000169435 . [Q6ZTQ3-3 ]
ENST00000342081 ; ENSP00000340578 ; ENSG00000169435 . [Q6ZTQ3-1 ]
ENST00000395777 ; ENSP00000379123 ; ENSG00000169435 . [Q6ZTQ3-4 ]
GeneIDi 166824.
KEGGi hsa:166824.
UCSCi uc003hhc.2. human. [Q6ZTQ3-1 ]
uc010iik.2. human. [Q6ZTQ3-4 ]
uc010iil.2. human. [Q6ZTQ3-3 ]

Organism-specific databases

CTDi 166824.
GeneCardsi GC04M074437.
HGNCi HGNC:20796. RASSF6.
HPAi HPA037711.
MIMi 612620. gene.
neXtProti NX_Q6ZTQ3.
PharmGKBi PA134900075.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG244901.
HOGENOMi HOG000231738.
HOVERGENi HBG054302.
InParanoidi Q6ZTQ3.
KOi K09854.
OMAi KHRASIN.
OrthoDBi EOG7DVDBF.
PhylomeDBi Q6ZTQ3.
TreeFami TF319243.

Miscellaneous databases

GenomeRNAii 166824.
NextBioi 88631.
PROi Q6ZTQ3.
SOURCEi Search...

Gene expression databases

Bgeei Q6ZTQ3.
CleanExi HS_RASSF6.
Genevestigatori Q6ZTQ3.

Family and domain databases

InterProi IPR000159. Ras-assoc.
IPR011524. SARAH_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view ]
Pfami PF00788. RA. 1 hit.
[Graphical view ]
SMARTi SM00314. RA. 1 hit.
[Graphical view ]
SUPFAMi SSF54236. SSF54236. 1 hit.
PROSITEi PS50200. RA. 1 hit.
PS50951. SARAH. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "RASSF6, a member of the RASSF family of putative tumor suppressors, is transcriptionally repressed in lung and breast cancers."
    Burbee D.G., White M.A., Miller D.S., Minna J.D., Muller C.Y.
    Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Trachea.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Small intestine.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT PRO-163.
    Tissue: Prostate.
  5. "Ras-association domain family protein 6 induces apoptosis via both caspase-dependent and caspase-independent pathways."
    Ikeda M., Hirabayashi S., Fujiwara N., Mori H., Kawata A., Iida J., Bao Y., Sato Y., Iida T., Sugimura H., Hata Y.
    Exp. Cell Res. 313:1484-1495(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, LACK OF INTERACTION WITH KRAS; MRAS; NRAS AND RRAS2.
  6. "RASSF6 is a novel member of the RASSF family of tumor suppressors."
    Allen N.P., Donninger H., Vos M.D., Eckfeld K., Hesson L., Gordon L., Birrer M.J., Latif F., Clark G.J.
    Oncogene 26:6203-6211(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiRASF6_HUMAN
AccessioniPrimary (citable) accession number: Q6ZTQ3
Secondary accession number(s): Q68DT2
, Q6PDA6, Q86WG9, Q86WH0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 5, 2004
Last modified: July 9, 2014
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi