Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase UBR3

Gene

UBR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation (By similarity).By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri118 – 18972UBR-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1306 – 136459RING-type; degenerateAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase UBR3 (EC:6.3.2.-)
Alternative name(s):
N-recognin-3
Ubiquitin-protein ligase E3-alpha-3
Ubiquitin-protein ligase E3-alpha-III
Zinc finger protein 650
Gene namesi
Name:UBR3
Synonyms:KIAA2024, ZNF650
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:30467. UBR3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei761 – 78121HelicalSequence analysisAdd
BLAST
Transmembranei919 – 93921HelicalSequence analysisAdd
BLAST
Transmembranei1806 – 182621HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162407919.

Polymorphism and mutation databases

BioMutaiUBR3.
DMDMi166214992.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 18881888E3 ubiquitin-protein ligase UBR3PRO_0000278184Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei343 – 3431PhosphoserineBy similarity
Modified residuei344 – 3441PhosphoserineBy similarity
Modified residuei1199 – 11991PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6ZT12.
MaxQBiQ6ZT12.
PaxDbiQ6ZT12.
PRIDEiQ6ZT12.

PTM databases

iPTMnetiQ6ZT12.
PhosphoSiteiQ6ZT12.

Expressioni

Gene expression databases

BgeeiQ6ZT12.
CleanExiHS_UBR3.
ExpressionAtlasiQ6ZT12. baseline and differential.
GenevisibleiQ6ZT12. HS.

Organism-specific databases

HPAiHPA035390.

Interactioni

Subunit structurei

Interacts with UBE2A and UBE2B.By similarity

Protein-protein interaction databases

BioGridi126237. 30 interactions.
IntActiQ6ZT12. 5 interactions.
STRINGi9606.ENSP00000396068.

Structurei

3D structure databases

ProteinModelPortaliQ6ZT12.
SMRiQ6ZT12. Positions 119-188.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1168 – 119932Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi2 – 118117Ala-richAdd
BLAST
Compositional biasi1766 – 180843Cys-richAdd
BLAST

Sequence similaritiesi

Belongs to the UBR1 family.Curated
Contains 1 RING-type zinc finger.Curated
Contains 1 UBR-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri118 – 18972UBR-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1306 – 136459RING-type; degenerateAdd
BLAST

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiKOG1139. Eukaryota.
ENOG410XRM3. LUCA.
GeneTreeiENSGT00530000063055.
HOVERGENiHBG108647.
InParanoidiQ6ZT12.
KOiK11978.
OMAiDAINCKE.
OrthoDBiEOG7R56RR.
PhylomeDBiQ6ZT12.
TreeFamiTF323875.

Family and domain databases

InterProiIPR003126. Znf_UBR.
[Graphical view]
PfamiPF02207. zf-UBR. 1 hit.
[Graphical view]
SMARTiSM00396. ZnF_UBR1. 1 hit.
[Graphical view]
PROSITEiPS51157. ZF_UBR. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZT12-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAAAAAVG GQQPSQPELP APGLALDKAA TAAHLKAALS RPDNRAGAEE
60 70 80 90 100
LQALLERVLS AERPLAAAAG GEDAAAAGGG GGPGAAEEEA LEWCKCLLAG
110 120 130 140 150
GGGYDEFCAA VRAYDPAALC GLVWTANFVA YRCRTCGISP CMSLCAECFH
160 170 180 190 200
QGDHTGHDFN MFRSQAGGAC DCGDSNVMRE SGFCKRHQIK SSSNIPCVPK
210 220 230 240 250
DLLMMSEFVL PRFIFCLIQY LREGYNEPAA DGPSEKDLNK VLQLLEPQIS
260 270 280 290 300
FLEDLTKMGG AMRSVLTQVL TNQQNYKDLT SGLGENACVK KSHEKYLIAL
310 320 330 340 350
KSSGLTYPED KLVYGVQEPS AGTSSLAVQG FIGATGTLGQ VDSSDEDDQD
360 370 380 390 400
GSQGLGKRKR VKLSSGTKDQ SIMDVLKHKS FLEELLFWTI KYEFPQKMVT
410 420 430 440 450
FLLNMLPDQE YKVAFTKTFV QHYAFIMKTL KKSHESDTMS NRIVHISVQL
460 470 480 490 500
FSNEELARQV TEECQLLDIM VTVLLYMMES CLIKSELQDE ENSLHVVVNC
510 520 530 540 550
GEALLKNNTY WPLVSDFINI LSHQSVAKRF LEDHGLLVTW MNFVSFFQGM
560 570 580 590 600
NLNKRELNEH VEFESQTYYA AFAAELEACA QPMWGLLSHC KVRETQEYTR
610 620 630 640 650
NVVRYCLEAL QDWFDAINFV DEPAPNQVTF HLPLHRYYAM FLSKAVKCQE
660 670 680 690 700
LDLDSVLPDQ EMLMKLMIHP LQIQASLAEI HSNMWVRNGL QIKGQAMTYV
710 720 730 740 750
QSHFCNSMID PDIYLLQVCA SRLDPDYFIS SVFERFKVVD LLTMASQHQN
760 770 780 790 800
TVLDAEHERS MLEGALTFLV ILLSLRLHLG MSDDEILRAE MVAQLCMNDR
810 820 830 840 850
THSSLLDLIP ENPNPKSGII PGSYSFESVL SAVADFKAPV FEPGGSMQQG
860 870 880 890 900
MYTPKAEVWD QEFDPVMVIL RTVYRRDVQS AMDRYTAFLK QSGKFPGNPW
910 920 930 940 950
PPYKKRTSLH PSYKGLMRLL HCKTLHIVLF TLLYKILMDH QNLSEHVLCM
960 970 980 990 1000
VLYLIELGLE NSAEEESDEE ASVGGPERCH DSWFPGSNLV SNMRHFINYV
1010 1020 1030 1040 1050
RVRVPETAPE VKRDSPASTS SDNLGSLQNS GTAQVFSLVA ERRKKFQEII
1060 1070 1080 1090 1100
NRSSSEANQV VRPKTSSKWS APGSAPQLTT AILEIKESIL SLLIKLHHKL
1110 1120 1130 1140 1150
SGKQNSYYPP WLDDIEILIQ PEIPKYSHGD GITAVERILL KAASQSRMNK
1160 1170 1180 1190 1200
RIIEEICRKV TPPVPPKKVT AAEKKTLDKE ERRQKARERQ QKLLAEFASR
1210 1220 1230 1240 1250
QKSFMETAMD VDSPENDIPM EITTAEPQVS EAVYDCVICG QSGPSSEDRP
1260 1270 1280 1290 1300
TGLVVLLQAS SVLGQCRDNV EPKKLPISEE EQIYPWDTCA AVHDVRLSLL
1310 1320 1330 1340 1350
QRYFKDSSCL LAVSIGWEGG VYVQTCGHTL HIDCHKSYME SLRNDQVLQG
1360 1370 1380 1390 1400
FSVDKGEFTC PLCRQFANSV LPCYPGSNVE NNPWQRPSNK SIQDLIKEVE
1410 1420 1430 1440 1450
ELQGRPGAFP SETNLSKEME SVMKDIKNTT QKKYRDYSKT PGSPDNDFLF
1460 1470 1480 1490 1500
MYSVARTNLE LELIHRGGNL CSGGASTAGK RSCLNQLFHV LALHMRLYSI
1510 1520 1530 1540 1550
DSEYNPWRKL TQLEEMNPQL GYEEQQPEVP ILYHDVTSLL LIQILMMPQP
1560 1570 1580 1590 1600
LRKDHFTCIV KVLFTLLYTQ ALAALSVKCS EEDRSAWKHA GALKKSTCDA
1610 1620 1630 1640 1650
EKSYEVLLSF VISELFKGKL YHEEGTQECA MVNPIAWSPE SMEKCLQDFC
1660 1670 1680 1690 1700
LPFLRITSLL QHHLFGEDLP SCQEEEEFSV LASCLGLLPT FYQTEHPFIS
1710 1720 1730 1740 1750
ASCLDWPVPA FDIITQWCFE IKSFTERHAE QGKALLIQES KWKLPHLLQL
1760 1770 1780 1790 1800
PENYNTIFQY YHRKTCSVCT KVPKDPAVCL VCGTFVCLKG LCCKQQSYCE
1810 1820 1830 1840 1850
CVLHSQNCGA GTGIFLLINA SVIIIIRGHR FCLWGSVYLD AHGEEDRDLR
1860 1870 1880
RGKPLYICKE RYKVLEQQWI SHTFDHINKR WGPHYNGL
Length:1,888
Mass (Da):212,433
Last modified:January 15, 2008 - v2
Checksum:i5F5525B33D2E9153
GO
Isoform 2 (identifier: Q6ZT12-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1179: Missing.
     1180-1211: EERRQKARERQQKLLAEFASRQKSFMETAMDV → MIASKQRQFTEVFRIMSSTFSQSRFLYAAVVT

Show »
Length:709
Mass (Da):80,668
Checksum:i31BAF308F2AD6FB1
GO
Isoform 3 (identifier: Q6ZT12-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1494: Missing.

Show »
Length:394
Mass (Da):45,533
Checksum:i4B1B5048589F8CA6
GO
Isoform 4 (identifier: Q6ZT12-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1485-1485: N → NFCFIISPFTKSEIILCQYRKSHDKVYPKY

Note: No experimental confirmation available.
Show »
Length:1,917
Mass (Da):215,971
Checksum:iD4EC272A57F7B564
GO

Sequence cautioni

The sequence BAC23120.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC86783.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC87032.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAG64179.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAD38857.1 differs from that shown. Reason: Erroneous termination at position 1525. Translated as Gln.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1791 – 17911L → F in BAC87032 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 14941494Missing in isoform 3. 1 PublicationVSP_023141Add
BLAST
Alternative sequencei1 – 11791179Missing in isoform 2. 1 PublicationVSP_030354Add
BLAST
Alternative sequencei1180 – 121132EERRQ…TAMDV → MIASKQRQFTEVFRIMSSTF SQSRFLYAAVVT in isoform 2. 1 PublicationVSP_023142Add
BLAST
Alternative sequencei1485 – 14851N → NFCFIISPFTKSEIILCQYR KSHDKVYPKY in isoform 4. 1 PublicationVSP_036405

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB095944 mRNA. Translation: BAC23120.1. Different initiation.
AK126998 mRNA. Translation: BAC86783.1. Different initiation.
AK127553 mRNA. Translation: BAC87032.1. Different initiation.
AK128490 mRNA. Translation: BAC87462.1.
AK303062 mRNA. Translation: BAG64179.1. Different initiation.
AC009967 Genomic DNA. No translation available.
AC079151 Genomic DNA. No translation available.
AC092641 Genomic DNA. Translation: AAY14890.1.
AL834144 mRNA. Translation: CAD38857.1. Sequence problems.
CCDSiCCDS2238.2. [Q6ZT12-1]
RefSeqiNP_742067.3. NM_172070.3. [Q6ZT12-1]
UniGeneiHs.379548.

Genome annotation databases

EnsembliENST00000272793; ENSP00000272793; ENSG00000144357. [Q6ZT12-1]
ENST00000418381; ENSP00000396068; ENSG00000144357. [Q6ZT12-1]
GeneIDi130507.
KEGGihsa:130507.
UCSCiuc010zdi.3. human. [Q6ZT12-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB095944 mRNA. Translation: BAC23120.1. Different initiation.
AK126998 mRNA. Translation: BAC86783.1. Different initiation.
AK127553 mRNA. Translation: BAC87032.1. Different initiation.
AK128490 mRNA. Translation: BAC87462.1.
AK303062 mRNA. Translation: BAG64179.1. Different initiation.
AC009967 Genomic DNA. No translation available.
AC079151 Genomic DNA. No translation available.
AC092641 Genomic DNA. Translation: AAY14890.1.
AL834144 mRNA. Translation: CAD38857.1. Sequence problems.
CCDSiCCDS2238.2. [Q6ZT12-1]
RefSeqiNP_742067.3. NM_172070.3. [Q6ZT12-1]
UniGeneiHs.379548.

3D structure databases

ProteinModelPortaliQ6ZT12.
SMRiQ6ZT12. Positions 119-188.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126237. 30 interactions.
IntActiQ6ZT12. 5 interactions.
STRINGi9606.ENSP00000396068.

PTM databases

iPTMnetiQ6ZT12.
PhosphoSiteiQ6ZT12.

Polymorphism and mutation databases

BioMutaiUBR3.
DMDMi166214992.

Proteomic databases

EPDiQ6ZT12.
MaxQBiQ6ZT12.
PaxDbiQ6ZT12.
PRIDEiQ6ZT12.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000272793; ENSP00000272793; ENSG00000144357. [Q6ZT12-1]
ENST00000418381; ENSP00000396068; ENSG00000144357. [Q6ZT12-1]
GeneIDi130507.
KEGGihsa:130507.
UCSCiuc010zdi.3. human. [Q6ZT12-1]

Organism-specific databases

CTDi130507.
GeneCardsiUBR3.
HGNCiHGNC:30467. UBR3.
HPAiHPA035390.
MIMi613831. gene.
neXtProtiNX_Q6ZT12.
PharmGKBiPA162407919.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1139. Eukaryota.
ENOG410XRM3. LUCA.
GeneTreeiENSGT00530000063055.
HOVERGENiHBG108647.
InParanoidiQ6ZT12.
KOiK11978.
OMAiDAINCKE.
OrthoDBiEOG7R56RR.
PhylomeDBiQ6ZT12.
TreeFamiTF323875.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

ChiTaRSiUBR3. human.
GenomeRNAii130507.
PROiQ6ZT12.
SOURCEiSearch...

Gene expression databases

BgeeiQ6ZT12.
CleanExiHS_UBR3.
ExpressionAtlasiQ6ZT12. baseline and differential.
GenevisibleiQ6ZT12. HS.

Family and domain databases

InterProiIPR003126. Znf_UBR.
[Graphical view]
PfamiPF02207. zf-UBR. 1 hit.
[Graphical view]
SMARTiSM00396. ZnF_UBR1. 1 hit.
[Graphical view]
PROSITEiPS51157. ZF_UBR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The nucleotide sequence of a long cDNA clone isolated from human."
    Nagase T., Kikuno R., Ohara O.
    Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1092-1888 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1330-1888 (ISOFORM 4).
    Tissue: Brain, Testis, Tongue and Trachea.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1432-1888 (ISOFORMS 1/2).
    Tissue: Testis.

Entry informationi

Entry nameiUBR3_HUMAN
AccessioniPrimary (citable) accession number: Q6ZT12
Secondary accession number(s): B4DZR7
, Q2KHN5, Q6ZR55, Q6ZSC2, Q8IVE7, Q8ND96
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: January 15, 2008
Last modified: June 8, 2016
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.