Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein shisa-6 homolog

Gene

SHISA6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein shisa-6 homolog
Gene namesi
Name:SHISA6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:34491. SHISA6.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini26 – 174149ExtracellularSequence analysisAdd
BLAST
Transmembranei175 – 19521HelicalSequence analysisAdd
BLAST
Topological domaini196 – 500305CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165432740.

Polymorphism and mutation databases

BioMutaiSHISA6.
DMDMi172046182.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence analysisAdd
BLAST
Chaini26 – 500475Protein shisa-6 homologPRO_0000326154Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi32 – 321N-linked (GlcNAc...)Sequence analysis
Glycosylationi59 – 591N-linked (GlcNAc...)Sequence analysis
Modified residuei391 – 3911PhosphoserineBy similarity
Modified residuei397 – 3971PhosphoserineBy similarity
Modified residuei409 – 4091PhosphoserineBy similarity
Modified residuei433 – 4331PhosphothreonineBy similarity
Modified residuei477 – 4771PhosphothreonineBy similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PRIDEiQ6ZSJ9.

PTM databases

iPTMnetiQ6ZSJ9.
PhosphoSiteiQ6ZSJ9.

Expressioni

Tissue specificityi

Expressed in the developing ventral mesencephalon.1 Publication

Gene expression databases

BgeeiQ6ZSJ9.
ExpressionAtlasiQ6ZSJ9. baseline and differential.
GenevisibleiQ6ZSJ9. HS.

Organism-specific databases

HPAiHPA023440.

Structurei

3D structure databases

ProteinModelPortaliQ6ZSJ9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi26 – 8863Ala-richAdd
BLAST

Sequence similaritiesi

Belongs to the shisa family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00510000047247.
HOGENOMiHOG000154745.
HOVERGENiHBG108632.
InParanoidiQ6ZSJ9.
OMAiDRYKMTK.
OrthoDBiEOG7QC7W2.
PhylomeDBiQ6ZSJ9.
TreeFamiTF330800.

Family and domain databases

InterProiIPR026910. Shisa.
[Graphical view]
PfamiPF13908. Shisa. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZSJ9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALRRLLLLL LLSLESLDLL PSVHGARGRA ANRTLSAGGA AVGGRRAGGA
60 70 80 90 100
LARGGRELNG TARAPGIPEA GSRRGQPAAA VAAAASAAVT YETCWGYYDV
110 120 130 140 150
SGQYDKEFEC NNSESGYLYC CGTCYYRFCC KKRHEKLDQR QCTNYQSPVW
160 170 180 190 200
VQTPSTKVVS PGPENKYDPE KDKTNFTVYI TCGVIAFVIV AGVFAKVSYD
210 220 230 240 250
KAHRPPREMN IHRALADILR QQGPIPIAHC ERETISAIDT SPKENTPVRS
260 270 280 290 300
SSKNHYTPVR TAKQTPEKPR MNNILTSATE PYDLSFSRSF QNLAHLPPSY
310 320 330 340 350
ESAVKTNPSK YSSLKRLTDK EADEYYMRRR HLPDLAARGT LPLNVIQMSQ
360 370 380 390 400
QKPLPRERPR RPIRAMSQDR VLSPDRGLPD EFSMPYDRIL SDEQLLSTER
410 420 430 440 450
LHSQDPLLSP ERTAFPEQSL SRAISHTDVF VSTPVLDRYR MSKMHSHPSA
460 470 480 490 500
SNNSYATLGQ SQTAAKRHAF ASRRHNTVEQ LHYIPGHHTC YTASKTEVTV
Length:500
Mass (Da):55,764
Last modified:March 18, 2008 - v2
Checksum:i3DEF68C298A101CB
GO
Isoform 2 (identifier: Q6ZSJ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-266: P → PGHYGKDAYRSGGPDLHNFISSGFVTLGRGHTK

Note: No experimental confirmation available.
Show »
Length:532
Mass (Da):59,179
Checksum:iCC22E71660F2E002
GO
Isoform 3 (identifier: Q6ZSJ9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-266: P → PGHYGKDAYRSGGPDLHNFISSGFVTLGRGHTKGDHQYNHPILSSVTQIPPH

Show »
Length:551
Mass (Da):61,301
Checksum:iC446246EFF7E0F0C
GO

Sequence cautioni

The sequence BAC86949.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG54617.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti250 – 2501S → P in AAY68487 (Ref. 3) Curated
Sequence conflicti297 – 2993PPS → SPP in AAY68487 (Ref. 3) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei266 – 2661P → PGHYGKDAYRSGGPDLHNFI SSGFVTLGRGHTK in isoform 2. 1 PublicationVSP_032565
Alternative sequencei266 – 2661P → PGHYGKDAYRSGGPDLHNFI SSGFVTLGRGHTKGDHQYNH PILSSVTQIPPH in isoform 3. 1 PublicationVSP_040558

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005725 Genomic DNA. No translation available.
AC007510 Genomic DNA. No translation available.
AC055825 Genomic DNA. No translation available.
AK127379 mRNA. Translation: BAC86949.1. Different initiation.
AK128003 mRNA. Translation: BAG54617.1. Different initiation.
DQ070854 mRNA. Translation: AAY68487.1.
CCDSiCCDS45615.1. [Q6ZSJ9-3]
CCDS54089.1. [Q6ZSJ9-2]
CCDS54090.1. [Q6ZSJ9-1]
RefSeqiNP_001166932.1. NM_001173461.1. [Q6ZSJ9-1]
NP_001166933.1. NM_001173462.1. [Q6ZSJ9-2]
NP_997269.2. NM_207386.3. [Q6ZSJ9-3]
UniGeneiHs.592124.
Hs.672782.

Genome annotation databases

EnsembliENST00000409168; ENSP00000387157; ENSG00000188803. [Q6ZSJ9-1]
ENST00000432116; ENSP00000388659; ENSG00000188803. [Q6ZSJ9-2]
ENST00000441885; ENSP00000390084; ENSG00000188803. [Q6ZSJ9-3]
GeneIDi388336.
KEGGihsa:388336.
UCSCiuc002gna.4. human. [Q6ZSJ9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005725 Genomic DNA. No translation available.
AC007510 Genomic DNA. No translation available.
AC055825 Genomic DNA. No translation available.
AK127379 mRNA. Translation: BAC86949.1. Different initiation.
AK128003 mRNA. Translation: BAG54617.1. Different initiation.
DQ070854 mRNA. Translation: AAY68487.1.
CCDSiCCDS45615.1. [Q6ZSJ9-3]
CCDS54089.1. [Q6ZSJ9-2]
CCDS54090.1. [Q6ZSJ9-1]
RefSeqiNP_001166932.1. NM_001173461.1. [Q6ZSJ9-1]
NP_001166933.1. NM_001173462.1. [Q6ZSJ9-2]
NP_997269.2. NM_207386.3. [Q6ZSJ9-3]
UniGeneiHs.592124.
Hs.672782.

3D structure databases

ProteinModelPortaliQ6ZSJ9.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiQ6ZSJ9.
PhosphoSiteiQ6ZSJ9.

Polymorphism and mutation databases

BioMutaiSHISA6.
DMDMi172046182.

Proteomic databases

PRIDEiQ6ZSJ9.

Protocols and materials databases

DNASUi388336.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000409168; ENSP00000387157; ENSG00000188803. [Q6ZSJ9-1]
ENST00000432116; ENSP00000388659; ENSG00000188803. [Q6ZSJ9-2]
ENST00000441885; ENSP00000390084; ENSG00000188803. [Q6ZSJ9-3]
GeneIDi388336.
KEGGihsa:388336.
UCSCiuc002gna.4. human. [Q6ZSJ9-1]

Organism-specific databases

CTDi388336.
GeneCardsiSHISA6.
HGNCiHGNC:34491. SHISA6.
HPAiHPA023440.
neXtProtiNX_Q6ZSJ9.
PharmGKBiPA165432740.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00510000047247.
HOGENOMiHOG000154745.
HOVERGENiHBG108632.
InParanoidiQ6ZSJ9.
OMAiDRYKMTK.
OrthoDBiEOG7QC7W2.
PhylomeDBiQ6ZSJ9.
TreeFamiTF330800.

Miscellaneous databases

ChiTaRSiSHISA6. human.
GenomeRNAii388336.
NextBioi101976.
PROiQ6ZSJ9.

Gene expression databases

BgeeiQ6ZSJ9.
ExpressionAtlasiQ6ZSJ9. baseline and differential.
GenevisibleiQ6ZSJ9. HS.

Family and domain databases

InterProiIPR026910. Shisa.
[Graphical view]
PfamiPF13908. Shisa. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 103-500 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 220-500 (ISOFORM 3).
    Tissue: Subthalamic nucleus.
  3. Lin L., Nong W., Zhou G., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Wen S., Li H., Yang S.
    Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 209-500 (ISOFORM 2).
  4. "Identification of novel genes regulated in the developing human ventral mesencephalon."
    Joergensen J.R., Juliusson B., Henriksen K.F., Hansen C., Knudsen S., Petersen T.N., Blom N., Seiger A., Wahlberg L.U.
    Exp. Neurol. 198:427-437(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiSHSA6_HUMAN
AccessioniPrimary (citable) accession number: Q6ZSJ9
Secondary accession number(s): B3KXV5, Q4PL63
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: March 16, 2016
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.