Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein shisa-6

Gene

SHISA6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Involved in maintenance of high-frequency synaptic transmission at hippocampal CA3-CA1 synapses. Regulates AMPA-type glutamate receptor (AMPAR) immobilization at postsynaptic density keeping the channels in an activated state in the presence of glutamate and preventing synaptic depression. May play a role in self-renewal and differentiation of spermatogonial stem cells by inhibiting canonical Wnt signaling pathway.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processWnt signaling pathway

Protein family/group databases

TCDBi8.A.83.1.1. the shisa6 regulator of short-term neuronal synaptic plasticity (shisa) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein shisa-6Curated
Gene namesi
Name:SHISA6Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000188803.14.
HGNCiHGNC:34491. SHISA6.
MIMi617327. gene.
neXtProtiNX_Q6ZSJ9.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 174ExtracellularSequence analysisAdd BLAST149
Transmembranei175 – 195HelicalSequence analysisAdd BLAST21
Topological domaini196 – 500CytoplasmicSequence analysisAdd BLAST305

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi388336.
OpenTargetsiENSG00000188803.
PharmGKBiPA165432740.

Polymorphism and mutation databases

BioMutaiSHISA6.
DMDMi172046182.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
ChainiPRO_000032615426 – 500Protein shisa-6Add BLAST475

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi32N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi59N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei391PhosphoserineBy similarity1
Modified residuei397PhosphoserineBy similarity1
Modified residuei409PhosphoserineBy similarity1
Modified residuei433PhosphothreonineBy similarity1
Modified residuei477PhosphothreonineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PeptideAtlasiQ6ZSJ9.
PRIDEiQ6ZSJ9.

PTM databases

iPTMnetiQ6ZSJ9.
PhosphoSitePlusiQ6ZSJ9.

Expressioni

Tissue specificityi

Expressed in the developing ventral mesencephalon.1 Publication

Gene expression databases

BgeeiENSG00000188803.
ExpressionAtlasiQ6ZSJ9. baseline and differential.
GenevisibleiQ6ZSJ9. HS.

Organism-specific databases

HPAiHPA023440.

Interactioni

Subunit structurei

Component of the postsynaptic hippocampal AMPA-type glutamate receptor (AMPAR) complex, at least composed of pore forming AMPAR subunits GRIA1, GRIA2 and GRIA3 and AMPAR auxiliary proteins SHISA6 and SHISA7. Interacts (via PDZ-binding motif) with DLG4/PSD-95 (via PDZ domain); the interaction is direct.By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ6ZSJ9. 14 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ6ZSJ9.
SMRiQ6ZSJ9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi497 – 500PDZ-bindingBy similarity4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi26 – 88Ala-richAdd BLAST63

Domaini

The PDZ-binding motif interacts with PDZ-domain of scaffolding protein DLG4.By similarity

Sequence similaritiesi

Belongs to the shisa family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00510000047247.
HOGENOMiHOG000154745.
HOVERGENiHBG108632.
InParanoidiQ6ZSJ9.
OMAiISQYDCE.
OrthoDBiEOG091G04W8.
PhylomeDBiQ6ZSJ9.
TreeFamiTF330800.

Family and domain databases

InterProiView protein in InterPro
IPR026910. Shisa.
PANTHERiPTHR31774. PTHR31774. 2 hits.
PfamiView protein in Pfam
PF13908. Shisa. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZSJ9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALRRLLLLL LLSLESLDLL PSVHGARGRA ANRTLSAGGA AVGGRRAGGA
60 70 80 90 100
LARGGRELNG TARAPGIPEA GSRRGQPAAA VAAAASAAVT YETCWGYYDV
110 120 130 140 150
SGQYDKEFEC NNSESGYLYC CGTCYYRFCC KKRHEKLDQR QCTNYQSPVW
160 170 180 190 200
VQTPSTKVVS PGPENKYDPE KDKTNFTVYI TCGVIAFVIV AGVFAKVSYD
210 220 230 240 250
KAHRPPREMN IHRALADILR QQGPIPIAHC ERETISAIDT SPKENTPVRS
260 270 280 290 300
SSKNHYTPVR TAKQTPEKPR MNNILTSATE PYDLSFSRSF QNLAHLPPSY
310 320 330 340 350
ESAVKTNPSK YSSLKRLTDK EADEYYMRRR HLPDLAARGT LPLNVIQMSQ
360 370 380 390 400
QKPLPRERPR RPIRAMSQDR VLSPDRGLPD EFSMPYDRIL SDEQLLSTER
410 420 430 440 450
LHSQDPLLSP ERTAFPEQSL SRAISHTDVF VSTPVLDRYR MSKMHSHPSA
460 470 480 490 500
SNNSYATLGQ SQTAAKRHAF ASRRHNTVEQ LHYIPGHHTC YTASKTEVTV
Length:500
Mass (Da):55,764
Last modified:March 18, 2008 - v2
Checksum:i3DEF68C298A101CB
GO
Isoform 2 (identifier: Q6ZSJ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-266: P → PGHYGKDAYRSGGPDLHNFISSGFVTLGRGHTK

Note: No experimental confirmation available.
Show »
Length:532
Mass (Da):59,179
Checksum:iCC22E71660F2E002
GO
Isoform 3 (identifier: Q6ZSJ9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-266: P → PGHYGKDAYRSGGPDLHNFISSGFVTLGRGHTKGDHQYNHPILSSVTQIPPH

Show »
Length:551
Mass (Da):61,301
Checksum:iC446246EFF7E0F0C
GO

Sequence cautioni

The sequence BAC86949 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG54617 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti250S → P in AAY68487 (Ref. 3) Curated1
Sequence conflicti297 – 299PPS → SPP in AAY68487 (Ref. 3) Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_032565266P → PGHYGKDAYRSGGPDLHNFI SSGFVTLGRGHTK in isoform 2. 1 Publication1
Alternative sequenceiVSP_040558266P → PGHYGKDAYRSGGPDLHNFI SSGFVTLGRGHTKGDHQYNH PILSSVTQIPPH in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005725 Genomic DNA. No translation available.
AC007510 Genomic DNA. No translation available.
AC055825 Genomic DNA. No translation available.
AK127379 mRNA. Translation: BAC86949.1. Different initiation.
AK128003 mRNA. Translation: BAG54617.1. Different initiation.
DQ070854 mRNA. Translation: AAY68487.1.
CCDSiCCDS45615.1. [Q6ZSJ9-3]
CCDS54089.1. [Q6ZSJ9-2]
CCDS54090.1. [Q6ZSJ9-1]
RefSeqiNP_001166932.1. NM_001173461.1. [Q6ZSJ9-1]
NP_001166933.1. NM_001173462.1. [Q6ZSJ9-2]
NP_997269.2. NM_207386.3. [Q6ZSJ9-3]
UniGeneiHs.592124.
Hs.672782.

Genome annotation databases

EnsembliENST00000409168; ENSP00000387157; ENSG00000188803. [Q6ZSJ9-1]
ENST00000432116; ENSP00000388659; ENSG00000188803. [Q6ZSJ9-2]
ENST00000441885; ENSP00000390084; ENSG00000188803. [Q6ZSJ9-3]
GeneIDi388336.
KEGGihsa:388336.
UCSCiuc002gna.4. human. [Q6ZSJ9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSHSA6_HUMAN
AccessioniPrimary (citable) accession number: Q6ZSJ9
Secondary accession number(s): B3KXV5, Q4PL63
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: March 28, 2018
This is version 95 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome