Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein shisa-6 homolog

Gene

SHISA6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:G66-31932-MONOMER.

Protein family/group databases

TCDBi8.A.83.1.1. the shisa6 regulator of short-term neuronal synaptic plasticity (shisa) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein shisa-6 homolog
Gene namesi
Name:SHISA6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:34491. SHISA6.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 174ExtracellularSequence analysisAdd BLAST149
Transmembranei175 – 195HelicalSequence analysisAdd BLAST21
Topological domaini196 – 500CytoplasmicSequence analysisAdd BLAST305

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi388336.
OpenTargetsiENSG00000188803.
PharmGKBiPA165432740.

Polymorphism and mutation databases

BioMutaiSHISA6.
DMDMi172046182.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
ChainiPRO_000032615426 – 500Protein shisa-6 homologAdd BLAST475

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi32N-linked (GlcNAc...)Sequence analysis1
Glycosylationi59N-linked (GlcNAc...)Sequence analysis1
Modified residuei391PhosphoserineBy similarity1
Modified residuei397PhosphoserineBy similarity1
Modified residuei409PhosphoserineBy similarity1
Modified residuei433PhosphothreonineBy similarity1
Modified residuei477PhosphothreonineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PeptideAtlasiQ6ZSJ9.
PRIDEiQ6ZSJ9.

PTM databases

iPTMnetiQ6ZSJ9.
PhosphoSitePlusiQ6ZSJ9.

Expressioni

Tissue specificityi

Expressed in the developing ventral mesencephalon.1 Publication

Gene expression databases

BgeeiENSG00000188803.
ExpressionAtlasiQ6ZSJ9. baseline and differential.
GenevisibleiQ6ZSJ9. HS.

Organism-specific databases

HPAiHPA023440.

Interactioni

Protein-protein interaction databases

IntActiQ6ZSJ9. 7 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ6ZSJ9.
SMRiQ6ZSJ9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi26 – 88Ala-richAdd BLAST63

Sequence similaritiesi

Belongs to the shisa family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00510000047247.
HOGENOMiHOG000154745.
HOVERGENiHBG108632.
InParanoidiQ6ZSJ9.
OMAiDRYKMTK.
OrthoDBiEOG091G04W8.
PhylomeDBiQ6ZSJ9.
TreeFamiTF330800.

Family and domain databases

InterProiIPR026910. Shisa.
[Graphical view]
PfamiPF13908. Shisa. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZSJ9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALRRLLLLL LLSLESLDLL PSVHGARGRA ANRTLSAGGA AVGGRRAGGA
60 70 80 90 100
LARGGRELNG TARAPGIPEA GSRRGQPAAA VAAAASAAVT YETCWGYYDV
110 120 130 140 150
SGQYDKEFEC NNSESGYLYC CGTCYYRFCC KKRHEKLDQR QCTNYQSPVW
160 170 180 190 200
VQTPSTKVVS PGPENKYDPE KDKTNFTVYI TCGVIAFVIV AGVFAKVSYD
210 220 230 240 250
KAHRPPREMN IHRALADILR QQGPIPIAHC ERETISAIDT SPKENTPVRS
260 270 280 290 300
SSKNHYTPVR TAKQTPEKPR MNNILTSATE PYDLSFSRSF QNLAHLPPSY
310 320 330 340 350
ESAVKTNPSK YSSLKRLTDK EADEYYMRRR HLPDLAARGT LPLNVIQMSQ
360 370 380 390 400
QKPLPRERPR RPIRAMSQDR VLSPDRGLPD EFSMPYDRIL SDEQLLSTER
410 420 430 440 450
LHSQDPLLSP ERTAFPEQSL SRAISHTDVF VSTPVLDRYR MSKMHSHPSA
460 470 480 490 500
SNNSYATLGQ SQTAAKRHAF ASRRHNTVEQ LHYIPGHHTC YTASKTEVTV
Length:500
Mass (Da):55,764
Last modified:March 18, 2008 - v2
Checksum:i3DEF68C298A101CB
GO
Isoform 2 (identifier: Q6ZSJ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-266: P → PGHYGKDAYRSGGPDLHNFISSGFVTLGRGHTK

Note: No experimental confirmation available.
Show »
Length:532
Mass (Da):59,179
Checksum:iCC22E71660F2E002
GO
Isoform 3 (identifier: Q6ZSJ9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-266: P → PGHYGKDAYRSGGPDLHNFISSGFVTLGRGHTKGDHQYNHPILSSVTQIPPH

Show »
Length:551
Mass (Da):61,301
Checksum:iC446246EFF7E0F0C
GO

Sequence cautioni

The sequence BAC86949 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG54617 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti250S → P in AAY68487 (Ref. 3) Curated1
Sequence conflicti297 – 299PPS → SPP in AAY68487 (Ref. 3) Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_032565266P → PGHYGKDAYRSGGPDLHNFI SSGFVTLGRGHTK in isoform 2. 1 Publication1
Alternative sequenceiVSP_040558266P → PGHYGKDAYRSGGPDLHNFI SSGFVTLGRGHTKGDHQYNH PILSSVTQIPPH in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005725 Genomic DNA. No translation available.
AC007510 Genomic DNA. No translation available.
AC055825 Genomic DNA. No translation available.
AK127379 mRNA. Translation: BAC86949.1. Different initiation.
AK128003 mRNA. Translation: BAG54617.1. Different initiation.
DQ070854 mRNA. Translation: AAY68487.1.
CCDSiCCDS45615.1. [Q6ZSJ9-3]
CCDS54089.1. [Q6ZSJ9-2]
CCDS54090.1. [Q6ZSJ9-1]
RefSeqiNP_001166932.1. NM_001173461.1. [Q6ZSJ9-1]
NP_001166933.1. NM_001173462.1. [Q6ZSJ9-2]
NP_997269.2. NM_207386.3. [Q6ZSJ9-3]
UniGeneiHs.592124.
Hs.672782.

Genome annotation databases

EnsembliENST00000409168; ENSP00000387157; ENSG00000188803. [Q6ZSJ9-1]
ENST00000432116; ENSP00000388659; ENSG00000188803. [Q6ZSJ9-2]
ENST00000441885; ENSP00000390084; ENSG00000188803. [Q6ZSJ9-3]
GeneIDi388336.
KEGGihsa:388336.
UCSCiuc002gna.4. human. [Q6ZSJ9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005725 Genomic DNA. No translation available.
AC007510 Genomic DNA. No translation available.
AC055825 Genomic DNA. No translation available.
AK127379 mRNA. Translation: BAC86949.1. Different initiation.
AK128003 mRNA. Translation: BAG54617.1. Different initiation.
DQ070854 mRNA. Translation: AAY68487.1.
CCDSiCCDS45615.1. [Q6ZSJ9-3]
CCDS54089.1. [Q6ZSJ9-2]
CCDS54090.1. [Q6ZSJ9-1]
RefSeqiNP_001166932.1. NM_001173461.1. [Q6ZSJ9-1]
NP_001166933.1. NM_001173462.1. [Q6ZSJ9-2]
NP_997269.2. NM_207386.3. [Q6ZSJ9-3]
UniGeneiHs.592124.
Hs.672782.

3D structure databases

ProteinModelPortaliQ6ZSJ9.
SMRiQ6ZSJ9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ6ZSJ9. 7 interactors.

Protein family/group databases

TCDBi8.A.83.1.1. the shisa6 regulator of short-term neuronal synaptic plasticity (shisa) family.

PTM databases

iPTMnetiQ6ZSJ9.
PhosphoSitePlusiQ6ZSJ9.

Polymorphism and mutation databases

BioMutaiSHISA6.
DMDMi172046182.

Proteomic databases

PeptideAtlasiQ6ZSJ9.
PRIDEiQ6ZSJ9.

Protocols and materials databases

DNASUi388336.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000409168; ENSP00000387157; ENSG00000188803. [Q6ZSJ9-1]
ENST00000432116; ENSP00000388659; ENSG00000188803. [Q6ZSJ9-2]
ENST00000441885; ENSP00000390084; ENSG00000188803. [Q6ZSJ9-3]
GeneIDi388336.
KEGGihsa:388336.
UCSCiuc002gna.4. human. [Q6ZSJ9-1]

Organism-specific databases

CTDi388336.
DisGeNETi388336.
GeneCardsiSHISA6.
HGNCiHGNC:34491. SHISA6.
HPAiHPA023440.
neXtProtiNX_Q6ZSJ9.
OpenTargetsiENSG00000188803.
PharmGKBiPA165432740.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00510000047247.
HOGENOMiHOG000154745.
HOVERGENiHBG108632.
InParanoidiQ6ZSJ9.
OMAiDRYKMTK.
OrthoDBiEOG091G04W8.
PhylomeDBiQ6ZSJ9.
TreeFamiTF330800.

Enzyme and pathway databases

BioCyciZFISH:G66-31932-MONOMER.

Miscellaneous databases

ChiTaRSiSHISA6. human.
GenomeRNAii388336.
PROiQ6ZSJ9.

Gene expression databases

BgeeiENSG00000188803.
ExpressionAtlasiQ6ZSJ9. baseline and differential.
GenevisibleiQ6ZSJ9. HS.

Family and domain databases

InterProiIPR026910. Shisa.
[Graphical view]
PfamiPF13908. Shisa. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSHSA6_HUMAN
AccessioniPrimary (citable) accession number: Q6ZSJ9
Secondary accession number(s): B3KXV5, Q4PL63
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: November 30, 2016
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.