Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat- and FYVE domain-containing protein 4

Gene

WDFY4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Enzyme and pathway databases

SignaLinkiQ6ZS81.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat- and FYVE domain-containing protein 4
Gene namesi
Name:WDFY4
Synonyms:C10orf64, KIAA1607
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:29323. WDFY4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1627 – 164721HelicalSequence analysisAdd
BLAST
Transmembranei2048 – 206821HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134967634.

Polymorphism and mutation databases

BioMutaiWDFY4.
DMDMi215274123.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 31843184WD repeat- and FYVE domain-containing protein 4PRO_0000251254Add
BLAST

Proteomic databases

EPDiQ6ZS81.
MaxQBiQ6ZS81.
PaxDbiQ6ZS81.
PeptideAtlasiQ6ZS81.
PRIDEiQ6ZS81.

PTM databases

iPTMnetiQ6ZS81.
PhosphoSiteiQ6ZS81.

Expressioni

Gene expression databases

BgeeiQ6ZS81.
CleanExiHS_WDFY4.
ExpressionAtlasiQ6ZS81. baseline and differential.
GenevisibleiQ6ZS81. HS.

Organism-specific databases

HPAiHPA040634.

Interactioni

Protein-protein interaction databases

BioGridi121729. 1 interaction.
IntActiQ6ZS81. 1 interaction.
STRINGi9606.ENSP00000320563.

Structurei

3D structure databases

ProteinModelPortaliQ6ZS81.
SMRiQ6ZS81. Positions 2465-2821, 2872-3099.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini2385 – 2510126BEACH-type PHPROSITE-ProRule annotationAdd
BLAST
Domaini2527 – 2821295BEACHPROSITE-ProRule annotationAdd
BLAST
Repeati2930 – 297041WD 1Add
BLAST
Repeati2980 – 301940WD 2Add
BLAST
Repeati3022 – 306140WD 3Add
BLAST
Repeati3071 – 310939WD 4Add
BLAST
Repeati3151 – 318434WD 5Add
BLAST

Sequence similaritiesi

Contains 1 BEACH domain.PROSITE-ProRule annotation
Contains 1 BEACH-type PH domain.PROSITE-ProRule annotation
Contains 5 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix, WD repeat

Phylogenomic databases

eggNOGiKOG1786. Eukaryota.
KOG1788. Eukaryota.
ENOG410XNQC. LUCA.
GeneTreeiENSGT00760000119083.
InParanoidiQ6ZS81.
OMAiVVRHMSR.
OrthoDBiEOG7F7W84.
PhylomeDBiQ6ZS81.
TreeFamiTF313658.

Family and domain databases

Gene3Di1.10.1540.10. 1 hit.
1.25.10.10. 4 hits.
2.130.10.10. 2 hits.
2.30.29.40. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000409. BEACH_dom.
IPR023362. PH-BEACH_dom.
IPR011993. PH_dom-like.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF02138. Beach. 1 hit.
PF00400. WD40. 2 hits.
[Graphical view]
SMARTiSM01026. Beach. 1 hit.
SM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 6 hits.
SSF50729. SSF50729. 1 hit.
SSF50978. SSF50978. 2 hits.
SSF81837. SSF81837. 1 hit.
PROSITEiPS50197. BEACH. 1 hit.
PS51783. PH_BEACH. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZS81-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAEDLSKAE DRNEDPGSKN EGQLAAVQPD VPHGGQSSSP TALWDMLERK
60 70 80 90 100
FLEYQQLTHK SPIERQKSLL SLLPLFLKAW EHSVGIICFP SLQRLAEDVS
110 120 130 140 150
DQLAQQLQKA LVGKPAEQAR LAAGQLLWWK GDVDQDGYLL LKSVYVLTGT
160 170 180 190 200
DSETLGRVAE SGLPALLLQC LYLFFVFPLD KDELLESDLQ VQKMFVQMLL
210 220 230 240 250
NICSDSQGLE GLLSGSELQS LLIATTCLRE HSCCFWKEPT FCVLRAISKA
260 270 280 290 300
QNLSIIQYLQ ATDCVRLSLQ NLSRLTDTLP APEVSEAVSL ILGFVKDSYP
310 320 330 340 350
VSSALFLEFE NSEGYPLLLK VLLRYDGLTQ SEVDPHLEEL LGLVVWLTTC
360 370 380 390 400
GRSELKVFDS ITYPQLEGFK FHHEASGVTV KNLQAFQVLQ NVFHKASDSV
410 420 430 440 450
LCIQVLSVIR TMWAWNARNF FLLEWTLQPI SQFVEIMPLK PAPVQEHFFQ
460 470 480 490 500
LLEALVFELH YVPHEILRKV QHLIKESPGP SCTLMALQSI LSIAGGDPLF
510 520 530 540 550
TDIFRDSGLL GLLLAQLRKQ AKIMRKSGNK VSTPGVQDPE RELTCVMLRI
560 570 580 590 600
VVTLLKGSVR NAVVLKDHGM VPFIKIFLDD ECYREASLSI LEQLSAINAE
610 620 630 640 650
EYMSIIVGAL CSSTQGELQL KLDLLKSLLR ILVTPKGRAA FRVSSGFNGL
660 670 680 690 700
LSLLSDLEGS LQEPPLQAWG AVSPRQTLEL VLYTLCAVSA ALHWDPVNGY
710 720 730 740 750
FFRRNGLFEK LAEDLCLLGC FGALEEEGNL LRSWVDTKAR PFADLLGTAF
760 770 780 790 800
SSSGSLPPRI QSCLQILGFL DSMASGTLHL RGDLKESLRT KQGPVVDVQK
810 820 830 840 850
GETGSDPQRN FKQWPDLEER MDEGDAAIMH PGVVCIMVRL LPRLYHEDHP
860 870 880 890 900
QLSEEIQCSL ASHIQSLVKS EKNRQVMCEA GLLGTLMASC HRALVTSGSP
910 920 930 940 950
LHSRLIRIFE KLASQAIEPD VLRQFLGLGI PSSLSATTKI LDSSHTHRGN
960 970 980 990 1000
PGCSGSQTAQ GLAEGPWPAA PDAGLHPGVT QAPQPLGESQ DSTTALQTAL
1010 1020 1030 1040 1050
SLISMTSPRN LQPQRAALAP SFVEFDMSVE GYGCLFIPTL STVMGTSTEY
1060 1070 1080 1090 1100
SVSGGIGTGA TRPFPPPGGL TFSCWFLISR HGAATEGHPL RFLTLVRHLA
1110 1120 1130 1140 1150
RTEQPFVCFS VSLCPDDLSL VVSTEEKEFQ PLDVMEPEDD SEPSAGCQLQ
1160 1170 1180 1190 1200
VRCGQLLACG QWHHLAVVVT KEMKRHCTVS TCLDGQVIGS AKMLYIQALP
1210 1220 1230 1240 1250
GPFLSMDPSA FVDVYGYIAT PRVWKQKSSL IWRLGPTYLF EEAISMETLE
1260 1270 1280 1290 1300
VINKLGPRYC GNFQAVHVQG EDLDSEATPF VAEERVSFGL HIASSSITSV
1310 1320 1330 1340 1350
ADIRNAYNEV DSRLIAKEMN ISSRDNAMPV FLLRNCAGHL SGSLRTIGAV
1360 1370 1380 1390 1400
AVGQLGVRVF HSSPAASSLD FIGGPAILLG LISLATDDHT MYAAVKVLHS
1410 1420 1430 1440 1450
VLTSNAMCDF LMQHICGYQI MAFLLRKKAS LLNHRIFQLI LSVAGTVELG
1460 1470 1480 1490 1500
FRSSAITNTG VFQHILCNFE LWMNTADNLE LSLFSHLLEI LQSPREGPRN
1510 1520 1530 1540 1550
AEAAHQAQLI PKLIFLFNEP SLIPSKISTI IGILACQLRG HFSTQDLLRI
1560 1570 1580 1590 1600
GLFVVYTLKP SSVNERQICM DGALDPSLPA GSQTSGKTIW LRNQLLEMLL
1610 1620 1630 1640 1650
SVISSPQLHL SSESKEEMFL KLGPDWFLLL LQGHLHASTT VLALKLLLYF
1660 1670 1680 1690 1700
LASPSLRTRF RDGLCAGSWV ERSTEGVDIV MDNLKSQSPL PEQSPCLLPG
1710 1720 1730 1740 1750
FRVLNDFLAH HVHIPEVYLI VSTFFLQTPL TELMDGPKDS LDAMLQWLLQ
1760 1770 1780 1790 1800
RHHQEEVLQA GLCTEGALLL LEMLKATMSQ PLAGSEDGAW AQTFPASVLQ
1810 1820 1830 1840 1850
FLSLVHRTYP QDPAWRAPEF LQTLAIAAFP LGAQKGVGAE STRNTSSPEA
1860 1870 1880 1890 1900
AAEGDSTVEG LQAPTKAHPA RRKLREFTQL LLRELLLGAS SPKQWLPLEV
1910 1920 1930 1940 1950
LLEASPDHAT SQQKRDFQSE VLLSAMELFH MTSGGDAAMF RDGKEPQPSA
1960 1970 1980 1990 2000
EAAAAPSLAN ISCFTQKLVE KLYSGMFSAD PRHILLFILE HIMVVIETAS
2010 2020 2030 2040 2050
SQRDTVLSTL YSSLNKVILY CLSKPQQSLS ECLGLLSILG FLQEHWDVVF
2060 2070 2080 2090 2100
ATYNSNISFL LCLMHCLLLL NERSYPEGFG LEPKPRMSTY HQVFLSPNED
2110 2120 2130 2140 2150
VKEKREDLPS LSDVQHNIQK TVQTLWQQLV AQRQQTLEDA FKIDLSVKPG
2160 2170 2180 2190 2200
EREVKIEEVT PLWEETMLKA WQHYLASEKK SLASRSNVAH HSKVTLWSGS
2210 2220 2230 2240 2250
LSSAMKLMPG RQAKDPECKT EDFVSCIENY RRRGQELYAS LYKDHVQRRK
2260 2270 2280 2290 2300
CGNIKAANAW ARIQEQLFGE LGLWSQGEET KPCSPWELDW REGPARMRKR
2310 2320 2330 2340 2350
IKRLSPLEAL SSGRHKESQD KNDHISQTNA ENQDELTLRE AEGEPDEVGV
2360 2370 2380 2390 2400
DCTQLTFFPA LHESLHSEDF LELCRERQVI LQELLDKEKV TQKFSLVIVQ
2410 2420 2430 2440 2450
GHLVSEGVLL FGHQHFYICE NFTLSPTGDV YCTRHCLSNI SDPFIFNLCS
2460 2470 2480 2490 2500
KDRSTDHYSC QCHSYADMRE LRQARFLLQD IALEIFFHNG YSKFLVFYNN
2510 2520 2530 2540 2550
DRSKAFKSFC SFQPSLKGKA TSEDTLSLRR YPGSDRIMLQ KWQKRDISNF
2560 2570 2580 2590 2600
EYLMYLNTAA GRTCNDYMQY PVFPWVLADY TSETLNLANP KIFRDLSKPM
2610 2620 2630 2640 2650
GAQTKERKLK FIQRFKEVEK TEGDMTVQCH YYTHYSSAII VASYLVRMPP
2660 2670 2680 2690 2700
FTQAFCALQG GSFDVADRMF HSVKSTWESA SRENMSDVRE LTPEFFYLPE
2710 2720 2730 2740 2750
FLTNCNGVEF GCMQDGTVLG DVQLPPWADG DPRKFISLHR KALESDFVSA
2760 2770 2780 2790 2800
NLHHWIDLIF GYKQQGPAAV DAVNIFHPYF YGDRMDLSSI TDPLIKSTIL
2810 2820 2830 2840 2850
GFVSNFGQVP KQLFTKPHPA RTAAGKPLPG KDVSTPVSLP GHPQPFFYSL
2860 2870 2880 2890 2900
QSLRPSQVTV KDMYLFSLGS ESPKGAIGHI VSTEKTILAV ERNKVLLPPL
2910 2920 2930 2940 2950
WNRTFSWGFD DFSCCLGSYG SDKVLMTFEN LAAWGRCLCA VCPSPTTIVT
2960 2970 2980 2990 3000
SGTSTVVCVW ELSMTKGRPR GLRLRQALYG HTQAVTCLAA SVTFSLLVSG
3010 3020 3030 3040 3050
SQDCTCILWD LDHLTHVTRL PAHREGISAI TISDVSGTIV SCAGAHLSLW
3060 3070 3080 3090 3100
NVNGQPLASI TTAWGPEGAI TCCCLMEGPA WDTSQIIITG SQDGMVRVWK
3110 3120 3130 3140 3150
TEDVKMSVPG RPAGEEPPAQ PPSPRGHKWE KNLALSRELD VSIALTGKPS
3160 3170 3180
KTSPAVTALA VSRNHTKLLV GDERGRIFCW SADG
Length:3,184
Mass (Da):353,610
Last modified:November 25, 2008 - v3
Checksum:i6743F924EE534E44
GO
Isoform 2 (identifier: Q6ZS81-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     627-654: SLLRILVTPKGRAAFRVSSGFNGLLSLL → VISSPPLRLASLWICTKRSTFAQAFVFM
     655-3184: Missing.

Note: No experimental confirmation available.
Show »
Length:654
Mass (Da):73,196
Checksum:iEC85C73B9A9BBE16
GO
Isoform 3 (identifier: Q6ZS81-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1007-1042: SPRNLQPQRAALAPSFVEFDMSVEGYGCLFIPTLST → FPACWKPNIWKDNLAQKPVAGDAAQCNIFPPASSVL
     1043-3184: Missing.

Show »
Length:1,042
Mass (Da):114,924
Checksum:i534C48ABE2A94BB1
GO
Isoform 4 (identifier: Q6ZS81-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3111-3184: RPAGEEPPAQ...GRIFCWSADG → LQMGRKREAA...QPSPWPMGLL

Note: No experimental confirmation available.
Show »
Length:3,176
Mass (Da):352,667
Checksum:iD7F5CFF17F2AADA1
GO
Isoform 5 (identifier: Q6ZS81-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2862-2920: DMYLFSLGSE...DFSCCLGSYG → GDSLAMHCLV...SRGVSSLGSV
     2921-3184: Missing.

Note: No experimental confirmation available.
Show »
Length:2,920
Mass (Da):325,232
Checksum:i73B0497433628D5D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1337 – 13371A → G in BAB84911 (Ref. 4) Curated
Sequence conflicti2595 – 25951D → G in AAH47574 (PubMed:15489334).Curated
Sequence conflicti2683 – 26831E → K in AAH47574 (PubMed:15489334).Curated
Sequence conflicti3118 – 31181P → L in AAH47574 (PubMed:15489334).Curated
Sequence conflicti3118 – 31181P → L in BAB13433 (PubMed:10997877).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti214 – 2141S → P.1 Publication
Corresponds to variant rs7072606 [ dbSNP | Ensembl ].
VAR_027684
Natural varianti944 – 9441S → F.
Corresponds to variant rs12242384 [ dbSNP | Ensembl ].
VAR_027685
Natural varianti2527 – 25271S → N.3 Publications
Corresponds to variant rs2663046 [ dbSNP | Ensembl ].
VAR_047261

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei627 – 65428SLLRI…LLSLL → VISSPPLRLASLWICTKRST FAQAFVFM in isoform 2. 1 PublicationVSP_020750Add
BLAST
Alternative sequencei655 – 31842530Missing in isoform 2. 1 PublicationVSP_020751Add
BLAST
Alternative sequencei1007 – 104236SPRNL…PTLST → FPACWKPNIWKDNLAQKPVA GDAAQCNIFPPASSVL in isoform 3. 1 PublicationVSP_035683Add
BLAST
Alternative sequencei1043 – 31842142Missing in isoform 3. 1 PublicationVSP_035684Add
BLAST
Alternative sequencei2862 – 292059DMYLF…LGSYG → GDSLAMHCLVSCPRVVPSVA GFLWRSSTTYLGKVLGTDFE WLHLQSQPDSRGVSSLGSV in isoform 5. 1 PublicationVSP_035685Add
BLAST
Alternative sequencei2921 – 3184264Missing in isoform 5. 1 PublicationVSP_035686Add
BLAST
Alternative sequencei3111 – 318474RPAGE…WSADG → LQMGRKREAAEALAQQCQAE GGRGDWGLSSAYRRNPQGLL PHSSQGRASGNHSSAAQPSP WPMGLL in isoform 4. 1 PublicationVSP_035687Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024502 mRNA. Translation: BAB15792.1.
AK127650 mRNA. Translation: BAC87073.1.
AC035139 Genomic DNA. No translation available.
AC060234 Genomic DNA. No translation available.
AC068898 Genomic DNA. No translation available.
BC015694 mRNA. Translation: AAH15694.2.
BC034937 mRNA. Translation: AAH34937.1.
BC047574 mRNA. Translation: AAH47574.1.
AK074085 mRNA. Translation: BAB84911.1.
AB046827 mRNA. Translation: BAB13433.1.
CCDSiCCDS44385.1. [Q6ZS81-1]
RefSeqiNP_065996.1. NM_020945.1. [Q6ZS81-1]
XP_005270061.1. XM_005270004.2. [Q6ZS81-1]
XP_011538288.1. XM_011539986.1. [Q6ZS81-1]
XP_011538290.1. XM_011539988.1. [Q6ZS81-1]
UniGeneiHs.287379.

Genome annotation databases

EnsembliENST00000325239; ENSP00000320563; ENSG00000128815. [Q6ZS81-1]
ENST00000360890; ENSP00000354141; ENSG00000128815. [Q6ZS81-2]
GeneIDi57705.
KEGGihsa:57705.
UCSCiuc001jgy.3. human. [Q6ZS81-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024502 mRNA. Translation: BAB15792.1.
AK127650 mRNA. Translation: BAC87073.1.
AC035139 Genomic DNA. No translation available.
AC060234 Genomic DNA. No translation available.
AC068898 Genomic DNA. No translation available.
BC015694 mRNA. Translation: AAH15694.2.
BC034937 mRNA. Translation: AAH34937.1.
BC047574 mRNA. Translation: AAH47574.1.
AK074085 mRNA. Translation: BAB84911.1.
AB046827 mRNA. Translation: BAB13433.1.
CCDSiCCDS44385.1. [Q6ZS81-1]
RefSeqiNP_065996.1. NM_020945.1. [Q6ZS81-1]
XP_005270061.1. XM_005270004.2. [Q6ZS81-1]
XP_011538288.1. XM_011539986.1. [Q6ZS81-1]
XP_011538290.1. XM_011539988.1. [Q6ZS81-1]
UniGeneiHs.287379.

3D structure databases

ProteinModelPortaliQ6ZS81.
SMRiQ6ZS81. Positions 2465-2821, 2872-3099.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121729. 1 interaction.
IntActiQ6ZS81. 1 interaction.
STRINGi9606.ENSP00000320563.

PTM databases

iPTMnetiQ6ZS81.
PhosphoSiteiQ6ZS81.

Polymorphism and mutation databases

BioMutaiWDFY4.
DMDMi215274123.

Proteomic databases

EPDiQ6ZS81.
MaxQBiQ6ZS81.
PaxDbiQ6ZS81.
PeptideAtlasiQ6ZS81.
PRIDEiQ6ZS81.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325239; ENSP00000320563; ENSG00000128815. [Q6ZS81-1]
ENST00000360890; ENSP00000354141; ENSG00000128815. [Q6ZS81-2]
GeneIDi57705.
KEGGihsa:57705.
UCSCiuc001jgy.3. human. [Q6ZS81-1]

Organism-specific databases

CTDi57705.
GeneCardsiWDFY4.
H-InvDBHIX0018000.
HGNCiHGNC:29323. WDFY4.
HPAiHPA040634.
MIMi613316. gene.
neXtProtiNX_Q6ZS81.
PharmGKBiPA134967634.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1786. Eukaryota.
KOG1788. Eukaryota.
ENOG410XNQC. LUCA.
GeneTreeiENSGT00760000119083.
InParanoidiQ6ZS81.
OMAiVVRHMSR.
OrthoDBiEOG7F7W84.
PhylomeDBiQ6ZS81.
TreeFamiTF313658.

Enzyme and pathway databases

SignaLinkiQ6ZS81.

Miscellaneous databases

ChiTaRSiWDFY4. human.
GenomeRNAii57705.
PROiQ6ZS81.
SOURCEiSearch...

Gene expression databases

BgeeiQ6ZS81.
CleanExiHS_WDFY4.
ExpressionAtlasiQ6ZS81. baseline and differential.
GenevisibleiQ6ZS81. HS.

Family and domain databases

Gene3Di1.10.1540.10. 1 hit.
1.25.10.10. 4 hits.
2.130.10.10. 2 hits.
2.30.29.40. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000409. BEACH_dom.
IPR023362. PH-BEACH_dom.
IPR011993. PH_dom-like.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF02138. Beach. 1 hit.
PF00400. WD40. 2 hits.
[Graphical view]
SMARTiSM01026. Beach. 1 hit.
SM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 6 hits.
SSF50729. SSF50729. 1 hit.
SSF50978. SSF50978. 2 hits.
SSF81837. SSF81837. 1 hit.
PROSITEiPS50197. BEACH. 1 hit.
PS51783. PH_BEACH. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2587-3184 (ISOFORM 5), VARIANT PRO-214.
    Tissue: Spleen.
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2286-3184 (ISOFORM 1), VARIANT ASN-2527.
    Tissue: B-cell, Brain and Lymph.
  4. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
    Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
    Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1290-3184 (ISOFORM 4), VARIANT ASN-2527.
    Tissue: Spleen.
  5. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1915-3184 (ISOFORM 1), VARIANT ASN-2527.
    Tissue: Brain.
  6. "Identification and characterization of ARHGAP24 and ARHGAP25 genes in silico."
    Katoh M., Katoh M.
    Int. J. Mol. Med. 14:333-338(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiWDFY4_HUMAN
AccessioniPrimary (citable) accession number: Q6ZS81
Secondary accession number(s): B9ZVP2
, Q86WZ4, Q8N4A3, Q8TEN7, Q96BE1, Q9H7H8, Q9HCG5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: November 25, 2008
Last modified: July 6, 2016
This is version 104 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.