Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 662

Gene

ZNF662

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri192 – 21423C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri220 – 24223C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri248 – 27023C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri276 – 29823C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri304 – 32623C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri332 – 35423C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri360 – 38223C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri388 – 41023C2H2-type 8PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 662
Gene namesi
Name:ZNF662
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:31930. ZNF662.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670510.

Polymorphism and mutation databases

BioMutaiZNF662.
DMDMi74758793.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 426426Zinc finger protein 662PRO_0000251196Add
BLAST

Proteomic databases

PRIDEiQ6ZS27.
TopDownProteomicsiQ6ZS27-1. [Q6ZS27-1]

PTM databases

PhosphoSiteiQ6ZS27.

Expressioni

Gene expression databases

BgeeiQ6ZS27.
ExpressionAtlasiQ6ZS27. baseline and differential.
GenevisibleiQ6ZS27. HS.

Organism-specific databases

HPAiHPA039116.
HPA040377.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TRAF1Q130773EBI-10255155,EBI-359224
TRAF2Q129333EBI-10255155,EBI-355744

Protein-protein interaction databases

BioGridi132979. 3 interactions.
IntActiQ6ZS27. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ6ZS27.
SMRiQ6ZS27. Positions 179-418.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 4444KRABPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 8 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri192 – 21423C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri220 – 24223C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri248 – 27023C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri276 – 29823C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri304 – 32623C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri332 – 35423C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri360 – 38223C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri388 – 41023C2H2-type 8PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00790000123072.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ6ZS27.
KOiK09228.
OMAiIFYICEE.
OrthoDBiEOG7KSX7Q.
PhylomeDBiQ6ZS27.

Family and domain databases

Gene3Di3.30.160.60. 8 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 3 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 8 hits.
[Graphical view]
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 8 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZS27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLENYGAVAS LAAFPFPKPA LISQLERGET PWCSVPRGAL DGEAPRGISS
60 70 80 90 100
GYPFLKPAGI SHPEQVEEPL NLKLQGEGPS LICPEGVLKR KKEDFILKEE
110 120 130 140 150
IIEEAQDLMV LSSGPQWCGS QELWFGKTCE EKSRLGRWPG YLNGGRMESS
160 170 180 190 200
TNDIIEVIVK DEMISVEESS GNTDVNNLLG IHHKILNEQI FYICEECGKC
210 220 230 240 250
FDQNEDFDQH QKTHNGEKVY GCKECGKAFS FRSHCIAHQR IHSGVKPYEC
260 270 280 290 300
QECAKAFVWK SNLIRHQRIH TGEKPFECKE CGKGFSQNTS LTQHQRIHTG
310 320 330 340 350
EKPYTCKECG KSFTRNPALL RHQRMHTGEK PYECKDCGKG FMWNSDLSQH
360 370 380 390 400
QRVHTGDKPH ECTDCGKSFF CKAHLIRHQR IHTGERPYKC NDCGKAFSQN
410 420
SVLIKHQRRH ARDKPYNCQI SHLLEH
Length:426
Mass (Da):48,496
Last modified:July 5, 2004 - v1
Checksum:iC43690B7773AF3DE
GO
Isoform 2 (identifier: Q6ZS27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-109: Missing.

Show »
Length:318
Mass (Da):36,759
Checksum:i32A942244CE1E0AF
GO
Isoform 3 (identifier: Q6ZS27-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAAVALASGTRLGLVLELLPGQPALPRARRESVTFEDVAVYFSENEWIGLGPAQRALYRDVM
     12-12: Missing.
     51-84: Missing.

Note: No experimental confirmation available.
Show »
Length:452
Mass (Da):51,408
Checksum:iAE041F57CDF49740
GO

Sequence cautioni

The sequence AAI28086.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti389 – 3891K → R in BAC87565 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti176 – 1761N → S.
Corresponds to variant rs60980399 [ dbSNP | Ensembl ].
VAR_061961

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MAAVALASGTRLGLVLELLP GQPALPRARRESVTFEDVAV YFSENEWIGLGPAQRALYRD VM in isoform 3. CuratedVSP_053783
Alternative sequencei2 – 109108Missing in isoform 2. 1 PublicationVSP_020745Add
BLAST
Alternative sequencei12 – 121Missing in isoform 3. CuratedVSP_053784
Alternative sequencei51 – 8434Missing in isoform 3. CuratedVSP_053785Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK127779 mRNA. Translation: BAC87129.1.
AK128676 mRNA. Translation: BAC87565.1.
AK131235 mRNA. Translation: BAD18417.1.
AC092043 Genomic DNA. No translation available.
BC128085 mRNA. Translation: AAI28086.1. Different initiation.
CCDSiCCDS2708.1. [Q6ZS27-1]
CCDS46807.1. [Q6ZS27-3]
RefSeqiNP_001128128.1. NM_001134656.1. [Q6ZS27-3]
NP_997287.2. NM_207404.3. [Q6ZS27-1]
UniGeneiHs.720173.

Genome annotation databases

EnsembliENST00000328199; ENSP00000329264; ENSG00000182983. [Q6ZS27-3]
ENST00000440367; ENSP00000405047; ENSG00000182983. [Q6ZS27-1]
GeneIDi389114.
KEGGihsa:389114.
UCSCiuc003cmi.3. human. [Q6ZS27-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK127779 mRNA. Translation: BAC87129.1.
AK128676 mRNA. Translation: BAC87565.1.
AK131235 mRNA. Translation: BAD18417.1.
AC092043 Genomic DNA. No translation available.
BC128085 mRNA. Translation: AAI28086.1. Different initiation.
CCDSiCCDS2708.1. [Q6ZS27-1]
CCDS46807.1. [Q6ZS27-3]
RefSeqiNP_001128128.1. NM_001134656.1. [Q6ZS27-3]
NP_997287.2. NM_207404.3. [Q6ZS27-1]
UniGeneiHs.720173.

3D structure databases

ProteinModelPortaliQ6ZS27.
SMRiQ6ZS27. Positions 179-418.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi132979. 3 interactions.
IntActiQ6ZS27. 2 interactions.

PTM databases

PhosphoSiteiQ6ZS27.

Polymorphism and mutation databases

BioMutaiZNF662.
DMDMi74758793.

Proteomic databases

PRIDEiQ6ZS27.
TopDownProteomicsiQ6ZS27-1. [Q6ZS27-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328199; ENSP00000329264; ENSG00000182983. [Q6ZS27-3]
ENST00000440367; ENSP00000405047; ENSG00000182983. [Q6ZS27-1]
GeneIDi389114.
KEGGihsa:389114.
UCSCiuc003cmi.3. human. [Q6ZS27-1]

Organism-specific databases

CTDi389114.
GeneCardsiZNF662.
HGNCiHGNC:31930. ZNF662.
HPAiHPA039116.
HPA040377.
neXtProtiNX_Q6ZS27.
PharmGKBiPA142670510.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00790000123072.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ6ZS27.
KOiK09228.
OMAiIFYICEE.
OrthoDBiEOG7KSX7Q.
PhylomeDBiQ6ZS27.

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

GenomeRNAii389114.
NextBioi102594.
PROiQ6ZS27.

Gene expression databases

BgeeiQ6ZS27.
ExpressionAtlasiQ6ZS27. baseline and differential.
GenevisibleiQ6ZS27. HS.

Family and domain databases

Gene3Di3.30.160.60. 8 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 3 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 8 hits.
[Graphical view]
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 8 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Amygdala, Brain and Uterus.
  2. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).

Entry informationi

Entry nameiZN662_HUMAN
AccessioniPrimary (citable) accession number: Q6ZS27
Secondary accession number(s): A1A4T9
, F8W7S8, Q6ZNF8, Q6ZQW8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: July 5, 2004
Last modified: May 11, 2016
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.