Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6ZS27 (ZN662_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 95. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 662
Gene names
Name:ZNF662
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length426 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May be involved in transcriptional regulation By similarity.

Subcellular location

Nucleus By similarity.

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 8 C2H2-type zinc fingers.

Contains 1 KRAB domain.

Sequence caution

The sequence AAI28086.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6ZS27-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6ZS27-2)

The sequence of this isoform differs from the canonical sequence as follows:
     2-109: Missing.
Isoform 3 (identifier: Q6ZS27-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAAVALASGTRLGLVLELLPGQPALPRARRESVTFEDVAVYFSENEWIGLGPAQRALYRDVM
     12-12: Missing.
     51-84: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 426426Zinc finger protein 662
PRO_0000251196

Regions

Domain1 – 4444KRAB
Zinc finger192 – 21423C2H2-type 1
Zinc finger220 – 24223C2H2-type 2
Zinc finger248 – 27023C2H2-type 3
Zinc finger276 – 29823C2H2-type 4
Zinc finger304 – 32623C2H2-type 5
Zinc finger332 – 35423C2H2-type 6
Zinc finger360 – 38223C2H2-type 7
Zinc finger388 – 41023C2H2-type 8

Natural variations

Alternative sequence11M → MAAVALASGTRLGLVLELLP GQPALPRARRESVTFEDVAV YFSENEWIGLGPAQRALYRD VM in isoform 3.
VSP_053783
Alternative sequence2 – 109108Missing in isoform 2.
VSP_020745
Alternative sequence121Missing in isoform 3.
VSP_053784
Alternative sequence51 – 8434Missing in isoform 3.
VSP_053785
Natural variant1761N → S.
Corresponds to variant rs60980399 [ dbSNP | Ensembl ].
VAR_061961

Experimental info

Sequence conflict3891K → R in BAC87565. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: C43690B7773AF3DE

FASTA42648,496
        10         20         30         40         50         60 
MLENYGAVAS LAAFPFPKPA LISQLERGET PWCSVPRGAL DGEAPRGISS GYPFLKPAGI 

        70         80         90        100        110        120 
SHPEQVEEPL NLKLQGEGPS LICPEGVLKR KKEDFILKEE IIEEAQDLMV LSSGPQWCGS 

       130        140        150        160        170        180 
QELWFGKTCE EKSRLGRWPG YLNGGRMESS TNDIIEVIVK DEMISVEESS GNTDVNNLLG 

       190        200        210        220        230        240 
IHHKILNEQI FYICEECGKC FDQNEDFDQH QKTHNGEKVY GCKECGKAFS FRSHCIAHQR 

       250        260        270        280        290        300 
IHSGVKPYEC QECAKAFVWK SNLIRHQRIH TGEKPFECKE CGKGFSQNTS LTQHQRIHTG 

       310        320        330        340        350        360 
EKPYTCKECG KSFTRNPALL RHQRMHTGEK PYECKDCGKG FMWNSDLSQH QRVHTGDKPH 

       370        380        390        400        410        420 
ECTDCGKSFF CKAHLIRHQR IHTGERPYKC NDCGKAFSQN SVLIKHQRRH ARDKPYNCQI 


SHLLEH 

« Hide

Isoform 2 [UniParc].

Checksum: 32A942244CE1E0AF
Show »

FASTA31836,759
Isoform 3 [UniParc].

Checksum: AE041F57CDF49740
Show »

FASTA45251,408

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Amygdala, Brain and Uterus.
[2]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK127779 mRNA. Translation: BAC87129.1.
AK128676 mRNA. Translation: BAC87565.1.
AK131235 mRNA. Translation: BAD18417.1.
AC092043 Genomic DNA. No translation available.
BC128085 mRNA. Translation: AAI28086.1. Different initiation.
RefSeqNP_001128128.1. NM_001134656.1.
NP_997287.2. NM_207404.3.
UniGeneHs.720173.

3D structure databases

ProteinModelPortalQ6ZS27.
SMRQ6ZS27. Positions 161-418.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ6ZS27.

Polymorphism databases

DMDM74758793.

Proteomic databases

PaxDbQ6ZS27.
PRIDEQ6ZS27.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000328199; ENSP00000329264; ENSG00000182983.
ENST00000440367; ENSP00000405047; ENSG00000182983. [Q6ZS27-1]
ENST00000541208; ENSP00000446208; ENSG00000182983. [Q6ZS27-1]
GeneID389114.
KEGGhsa:389114.
UCSCuc003cmi.2. human. [Q6ZS27-1]

Organism-specific databases

CTD389114.
GeneCardsGC03P042947.
HGNCHGNC:31930. ZNF662.
HPAHPA039116.
HPA040377.
neXtProtNX_Q6ZS27.
PharmGKBPA142670510.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOGENOMHOG000234617.
HOVERGENHBG018163.
InParanoidQ6ZS27.
KOK09228.
OMAIFYICEE.
OrthoDBEOG7KSX7Q.
PhylomeDBQ6ZS27.

Enzyme and pathway databases

ReactomeREACT_71. Gene Expression.

Gene expression databases

ArrayExpressQ6ZS27.
BgeeQ6ZS27.
GenevestigatorQ6ZS27.

Family and domain databases

Gene3D3.30.160.60. 8 hits.
InterProIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 8 hits.
[Graphical view]
PROSITEPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 8 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi389114.
NextBio102594.
PROQ6ZS27.

Entry information

Entry nameZN662_HUMAN
AccessionPrimary (citable) accession number: Q6ZS27
Secondary accession number(s): A1A4T9 expand/collapse secondary AC list , F8W7S8, Q6ZNF8, Q6ZQW8
Entry history
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM