Q6ZRI8 (RHG36_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 72.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rho GTPase-activating protein 36 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 547 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state By similarity. |
| Sequence similarities | Contains 1 Rho-GAP domain. |
| Sequence caution | The sequence AAH63790.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAI41400.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | GTPase activation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | positive regulation of GTPase activity Inferred from electronic annotation. Source: GOC regulation of small GTPase mediated signal transductionTraceable author statement. Source: Reactome small GTPase mediated signal transductionTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | GTPase activator activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6ZRI8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6ZRI8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-32: MGGCIPFLKAARALCPRIMPPLLLLSAFIFLV → M | ||||||
| Isoform 3 (identifier: Q6ZRI8-3) The sequence of this isoform differs from the canonical sequence as follows: 1-136: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q6ZRI8-4) The sequence of this isoform differs from the canonical sequence as follows: 1-31: MGGCIPFLKAARALCPRIMPPLLLLSAFIFL → MAWILDCLFASAFEPRPRR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q6ZRI8-5) The sequence of this isoform differs from the canonical sequence as follows: 1-48: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 40 | 40 | Potential | ||||||
| Chain | 41 – 547 | 507 | Rho GTPase-activating protein 36 | PRO_0000256699 | |||||
Regions | |||||||||
| Domain | 226 – 426 | 201 | Rho-GAP | ||||||
| Compositional bias | 149 – 185 | 37 | Arg-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 136 | 136 | Missing in isoform 3. | VSP_021357 | |||||
| Alternative sequence | 1 – 48 | 48 | Missing in isoform 5. | VSP_039235 | |||||
| Alternative sequence | 1 – 32 | 32 | MGGCI…FIFLV → M in isoform 2. | VSP_021358 | |||||
| Alternative sequence | 1 – 31 | 31 | MGGCI…AFIFL → MAWILDCLFASAFEPRPRR in isoform 4. | VSP_039236 | |||||
Experimental info | |||||||||
| Sequence conflict | 340 | 1 | H → R in BAH12425. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK054620 mRNA. Translation: BAB70776.1. AK128203 mRNA. Translation: BAC87322.1. AK294274 mRNA. Translation: BAH11720.1. AK296748 mRNA. Translation: BAH12425.1. AL590131 Genomic DNA. Translation: CAI41399.1. AL590131 Genomic DNA. Translation: CAI41400.1. Different initiation. AL590131 Genomic DNA. Translation: CAI41401.1. AL590131 Genomic DNA. Translation: CAI41398.1. CH471107 Genomic DNA. Translation: EAX11793.1. BC063790 mRNA. Translation: AAH63790.1. Different initiation. |
| IPI | IPI00289435. IPI00642514. IPI00643199. IPI00964863. IPI00965160. |
| RefSeq | NP_659404.2. NM_144967.3. |
| UniGene | Hs.22905. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1RGP based on UniProtKB Q07960. |
| ProteinModelPortal | Q6ZRI8. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q6ZRI8. |
Polymorphism databases | |
| DMDM | 74722974. |
Proteomic databases | |
| PaxDb | Q6ZRI8. |
| PRIDE | Q6ZRI8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000276211; ENSP00000276211; ENSG00000147256. ENST00000370921; ENSP00000359959; ENSG00000147256. ENST00000370922; ENSP00000359960; ENSG00000147256. ENST00000412432; ENSP00000408515; ENSG00000147256. ENST00000423277; ENSP00000409218; ENSG00000147256. |
| GeneID | 158763. |
| KEGG | hsa:158763. |
| UCSC | uc004evz.3. human. uc004ewa.3. human. uc004ewb.3. human. |
Organism-specific databases | |
| CTD | 158763. |
| GeneCards | GC0XP130192. |
| HGNC | HGNC:26388. ARHGAP36. |
| HPA | HPA002064. |
| neXtProt | NX_Q6ZRI8. |
| PharmGKB | PA165756384. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG283137. |
| HOVERGEN | HBG056228. |
| InParanoid | Q6ZRI8. |
| OMA | FLSEFKP. |
| OrthoDB | EOG4XKV6S. |
| PhylomeDB | Q6ZRI8. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| Bgee | Q6ZRI8. |
| Genevestigator | Q6ZRI8. |
| GermOnline | ENSG00000147256. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.555.10. 2 hits. |
| InterPro | IPR008936. Rho_GTPase_activation_prot. IPR000198. RhoGAP_dom. [Graphical view] |
| Pfam | PF00620. RhoGAP. 1 hit. [Graphical view] |
| SMART | SM00324. RhoGAP. 1 hit. [Graphical view] |
| SUPFAM | SSF48350. Rho_GAP. 1 hit. |
| PROSITE | PS50238. RHOGAP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 158763. |
| NextBio | 87792. |
Entry information
| Entry name | RHG36_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6ZRI8 Secondary accession number(s): B7Z234 Q96NU6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
