Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6ZRI8 (RHG36_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 80. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Rho GTPase-activating protein 36
Gene names
Name:ARHGAP36
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length547 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state By similarity.

Sequence similarities

Contains 1 Rho-GAP domain.

Sequence caution

The sequence AAH63790.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAI41400.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainSignal
   Molecular functionGTPase activation
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processregulation of small GTPase mediated signal transduction

Traceable author statement. Source: Reactome

small GTPase mediated signal transduction

Traceable author statement. Source: Reactome

   Cellular_componentcytosol

Traceable author statement. Source: Reactome

   Molecular_functionGTPase activator activity

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6ZRI8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6ZRI8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGGCIPFLKAARALCPRIMPPLLLLSAFIFLV → M
Isoform 3 (identifier: Q6ZRI8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6ZRI8-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MGGCIPFLKAARALCPRIMPPLLLLSAFIFL → MAWILDCLFASAFEPRPRR
Note: No experimental confirmation available.
Isoform 5 (identifier: Q6ZRI8-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 4040 Potential
Chain41 – 547507Rho GTPase-activating protein 36
PRO_0000256699

Regions

Domain226 – 426201Rho-GAP
Compositional bias149 – 18537Arg-rich

Natural variations

Alternative sequence1 – 136136Missing in isoform 3.
VSP_021357
Alternative sequence1 – 4848Missing in isoform 5.
VSP_039235
Alternative sequence1 – 3232MGGCI…FIFLV → M in isoform 2.
VSP_021358
Alternative sequence1 – 3131MGGCI…AFIFL → MAWILDCLFASAFEPRPRR in isoform 4.
VSP_039236

Experimental info

Sequence conflict3401H → R in BAH12425. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 28EB8168F3928DF9

FASTA54761,664
        10         20         30         40         50         60 
MGGCIPFLKA ARALCPRIMP PLLLLSAFIF LVSVLGGAPG HNPDRRTKMV SIHSLSELER 

        70         80         90        100        110        120 
LKLQETAYHE LVARHFLSEF KPDRALPIDR PNTLDKWFLI LRGQQRAVSH KTFGISLEEV 

       130        140        150        160        170        180 
LVNEFTRRKH LELTATMQVE EATGQAAGRR RGNVVRRVFG RIRRFFSRRR NEPTLPREFT 

       190        200        210        220        230        240 
RRGRRGAVSV DSLAELEDGA LLLQTLQLSK ISFPIGQRLL GSKRKMSLNP IAKQIPQVVE 

       250        260        270        280        290        300 
ACCQFIEKHG LSAVGIFTLE YSVQRVRQLR EEFDQGLDVV LDDNQNVHDV AALLKEFFRD 

       310        320        330        340        350        360 
MKDSLLPDDL YMSFLLTATL KPQDQLSALQ LLVYLMPPCH SDTLERLLKA LHKITENCED 

       370        380        390        400        410        420 
SIGIDGQLVP GNRMTSTNLA LVFGSALLKK GKFGKRESRK TKLGIDHYVA SVNVVRAMID 

       430        440        450        460        470        480 
NWDVLFQVPP HIQRQVAKRV WKSSPEALDF IRRRNLRKIQ SARIKMEEDA LLSDPVETSA 

       490        500        510        520        530        540 
EARAAVLAQS KPSDEGSSEE PAVPSGTARS HDDEEGAGNP PIPEQDRPLL RVPREKEAKT 


GVSYFFP 

« Hide

Isoform 2 [UniParc].

Checksum: 15B94C6E4A812CD8
Show »

FASTA51658,340
Isoform 3 [UniParc].

Checksum: 58C7DFD0D4CE3822
Show »

FASTA41146,230
Isoform 4 [UniParc].

Checksum: A2B54A40702F287F
Show »

FASTA53560,570
Isoform 5 [UniParc].

Checksum: 0D1D47E6A5A25B29
Show »

FASTA49956,565

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
Tissue: Adrenal gland, Amygdala, Testis and Tongue.
[2]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: PNS.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK054620 mRNA. Translation: BAB70776.1.
AK128203 mRNA. Translation: BAC87322.1.
AK294274 mRNA. Translation: BAH11720.1.
AK296748 mRNA. Translation: BAH12425.1.
AL590131 Genomic DNA. Translation: CAI41399.1.
AL590131 Genomic DNA. Translation: CAI41400.1. Different initiation.
AL590131 Genomic DNA. Translation: CAI41401.1.
AL590131 Genomic DNA. Translation: CAI41398.1.
CH471107 Genomic DNA. Translation: EAX11793.1.
BC063790 mRNA. Translation: AAH63790.1. Different initiation.
RefSeqNP_001269536.1. NM_001282607.1.
NP_659404.2. NM_144967.3.
UniGeneHs.22905.

3D structure databases

ProteinModelPortalQ6ZRI8.
SMRQ6ZRI8. Positions 190-426.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127703. 1 interaction.

PTM databases

PhosphoSiteQ6ZRI8.

Polymorphism databases

DMDM74722974.

Proteomic databases

PaxDbQ6ZRI8.
PRIDEQ6ZRI8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000276211; ENSP00000276211; ENSG00000147256. [Q6ZRI8-1]
ENST00000370921; ENSP00000359959; ENSG00000147256. [Q6ZRI8-3]
ENST00000370922; ENSP00000359960; ENSG00000147256. [Q6ZRI8-4]
ENST00000412432; ENSP00000408515; ENSG00000147256. [Q6ZRI8-2]
GeneID158763.
KEGGhsa:158763.
UCSCuc004evz.3. human. [Q6ZRI8-1]
uc004ewa.3. human. [Q6ZRI8-4]
uc004ewb.3. human. [Q6ZRI8-2]

Organism-specific databases

CTD158763.
GeneCardsGC0XP130192.
HGNCHGNC:26388. ARHGAP36.
HPAHPA002064.
neXtProtNX_Q6ZRI8.
PharmGKBPA165756384.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG283137.
HOVERGENHBG056228.
InParanoidQ6ZRI8.
OMASEFKPDR.
OrthoDBEOG7FJH1S.
PhylomeDBQ6ZRI8.
TreeFamTF316710.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

BgeeQ6ZRI8.
GenevestigatorQ6ZRI8.

Family and domain databases

Gene3D1.10.555.10. 2 hits.
InterProIPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamPF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTSM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMSSF48350. SSF48350. 1 hit.
PROSITEPS50238. RHOGAP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi158763.
NextBio87792.
PROQ6ZRI8.

Entry information

Entry nameRHG36_HUMAN
AccessionPrimary (citable) accession number: Q6ZRI8
Secondary accession number(s): B7Z234 expand/collapse secondary AC list , B7Z439, Q5JRL9, Q5JRM0, Q5JRM1, Q96NU6
Entry history
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 80 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM