Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6ZRI8

- RHG36_HUMAN

UniProt

Q6ZRI8 - RHG36_HUMAN

Protein

Rho GTPase-activating protein 36

Gene

ARHGAP36

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 85 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.By similarity

    GO - Molecular functioni

    1. GTPase activator activity Source: UniProtKB-KW

    GO - Biological processi

    1. regulation of small GTPase mediated signal transduction Source: Reactome
    2. small GTPase mediated signal transduction Source: Reactome

    Keywords - Molecular functioni

    GTPase activation

    Enzyme and pathway databases

    ReactomeiREACT_11051. Rho GTPase cycle.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Rho GTPase-activating protein 36
    Gene namesi
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:26388. ARHGAP36.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA165756384.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 4040Sequence AnalysisAdd
    BLAST
    Chaini41 – 547507Rho GTPase-activating protein 36PRO_0000256699Add
    BLAST

    Proteomic databases

    PaxDbiQ6ZRI8.
    PRIDEiQ6ZRI8.

    PTM databases

    PhosphoSiteiQ6ZRI8.

    Expressioni

    Gene expression databases

    BgeeiQ6ZRI8.
    GenevestigatoriQ6ZRI8.

    Organism-specific databases

    HPAiHPA002064.

    Interactioni

    Protein-protein interaction databases

    BioGridi127703. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6ZRI8.
    SMRiQ6ZRI8. Positions 203-426.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini226 – 426201Rho-GAPPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi149 – 18537Arg-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG283137.
    HOVERGENiHBG056228.
    InParanoidiQ6ZRI8.
    OMAiSEFKPDR.
    OrthoDBiEOG7FJH1S.
    PhylomeDBiQ6ZRI8.
    TreeFamiTF316710.

    Family and domain databases

    Gene3Di1.10.555.10. 2 hits.
    InterProiIPR008936. Rho_GTPase_activation_prot.
    IPR000198. RhoGAP_dom.
    [Graphical view]
    PfamiPF00620. RhoGAP. 1 hit.
    [Graphical view]
    SMARTiSM00324. RhoGAP. 1 hit.
    [Graphical view]
    SUPFAMiSSF48350. SSF48350. 1 hit.
    PROSITEiPS50238. RHOGAP. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6ZRI8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGGCIPFLKA ARALCPRIMP PLLLLSAFIF LVSVLGGAPG HNPDRRTKMV    50
    SIHSLSELER LKLQETAYHE LVARHFLSEF KPDRALPIDR PNTLDKWFLI 100
    LRGQQRAVSH KTFGISLEEV LVNEFTRRKH LELTATMQVE EATGQAAGRR 150
    RGNVVRRVFG RIRRFFSRRR NEPTLPREFT RRGRRGAVSV DSLAELEDGA 200
    LLLQTLQLSK ISFPIGQRLL GSKRKMSLNP IAKQIPQVVE ACCQFIEKHG 250
    LSAVGIFTLE YSVQRVRQLR EEFDQGLDVV LDDNQNVHDV AALLKEFFRD 300
    MKDSLLPDDL YMSFLLTATL KPQDQLSALQ LLVYLMPPCH SDTLERLLKA 350
    LHKITENCED SIGIDGQLVP GNRMTSTNLA LVFGSALLKK GKFGKRESRK 400
    TKLGIDHYVA SVNVVRAMID NWDVLFQVPP HIQRQVAKRV WKSSPEALDF 450
    IRRRNLRKIQ SARIKMEEDA LLSDPVETSA EARAAVLAQS KPSDEGSSEE 500
    PAVPSGTARS HDDEEGAGNP PIPEQDRPLL RVPREKEAKT GVSYFFP 547
    Length:547
    Mass (Da):61,664
    Last modified:July 5, 2004 - v1
    Checksum:i28EB8168F3928DF9
    GO
    Isoform 2 (identifier: Q6ZRI8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MGGCIPFLKAARALCPRIMPPLLLLSAFIFLV → M

    Show »
    Length:516
    Mass (Da):58,340
    Checksum:i15B94C6E4A812CD8
    GO
    Isoform 3 (identifier: Q6ZRI8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-136: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:411
    Mass (Da):46,230
    Checksum:i58C7DFD0D4CE3822
    GO
    Isoform 4 (identifier: Q6ZRI8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-31: MGGCIPFLKAARALCPRIMPPLLLLSAFIFL → MAWILDCLFASAFEPRPRR

    Note: No experimental confirmation available.

    Show »
    Length:535
    Mass (Da):60,570
    Checksum:iA2B54A40702F287F
    GO
    Isoform 5 (identifier: Q6ZRI8-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-48: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:499
    Mass (Da):56,565
    Checksum:i0D1D47E6A5A25B29
    GO

    Sequence cautioni

    The sequence AAH63790.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAI41400.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti340 – 3401H → R in BAH12425. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 136136Missing in isoform 3. 1 PublicationVSP_021357Add
    BLAST
    Alternative sequencei1 – 4848Missing in isoform 5. 1 PublicationVSP_039235Add
    BLAST
    Alternative sequencei1 – 3232MGGCI…FIFLV → M in isoform 2. 1 PublicationVSP_021358Add
    BLAST
    Alternative sequencei1 – 3131MGGCI…AFIFL → MAWILDCLFASAFEPRPRR in isoform 4. 1 PublicationVSP_039236Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK054620 mRNA. Translation: BAB70776.1.
    AK128203 mRNA. Translation: BAC87322.1.
    AK294274 mRNA. Translation: BAH11720.1.
    AK296748 mRNA. Translation: BAH12425.1.
    AL590131 Genomic DNA. Translation: CAI41399.1.
    AL590131 Genomic DNA. Translation: CAI41400.1. Different initiation.
    AL590131 Genomic DNA. Translation: CAI41401.1.
    AL590131 Genomic DNA. Translation: CAI41398.1.
    CH471107 Genomic DNA. Translation: EAX11793.1.
    BC063790 mRNA. Translation: AAH63790.1. Different initiation.
    CCDSiCCDS14628.1. [Q6ZRI8-1]
    CCDS65320.1. [Q6ZRI8-4]
    RefSeqiNP_001269536.1. NM_001282607.1. [Q6ZRI8-4]
    NP_659404.2. NM_144967.3. [Q6ZRI8-1]
    XP_006724792.1. XM_006724729.1. [Q6ZRI8-3]
    UniGeneiHs.22905.

    Genome annotation databases

    EnsembliENST00000276211; ENSP00000276211; ENSG00000147256. [Q6ZRI8-1]
    ENST00000370921; ENSP00000359959; ENSG00000147256. [Q6ZRI8-3]
    ENST00000370922; ENSP00000359960; ENSG00000147256. [Q6ZRI8-4]
    ENST00000412432; ENSP00000408515; ENSG00000147256. [Q6ZRI8-2]
    GeneIDi158763.
    KEGGihsa:158763.
    UCSCiuc004evz.3. human. [Q6ZRI8-1]
    uc004ewa.3. human. [Q6ZRI8-4]
    uc004ewb.3. human. [Q6ZRI8-2]

    Polymorphism databases

    DMDMi74722974.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK054620 mRNA. Translation: BAB70776.1 .
    AK128203 mRNA. Translation: BAC87322.1 .
    AK294274 mRNA. Translation: BAH11720.1 .
    AK296748 mRNA. Translation: BAH12425.1 .
    AL590131 Genomic DNA. Translation: CAI41399.1 .
    AL590131 Genomic DNA. Translation: CAI41400.1 . Different initiation.
    AL590131 Genomic DNA. Translation: CAI41401.1 .
    AL590131 Genomic DNA. Translation: CAI41398.1 .
    CH471107 Genomic DNA. Translation: EAX11793.1 .
    BC063790 mRNA. Translation: AAH63790.1 . Different initiation.
    CCDSi CCDS14628.1. [Q6ZRI8-1 ]
    CCDS65320.1. [Q6ZRI8-4 ]
    RefSeqi NP_001269536.1. NM_001282607.1. [Q6ZRI8-4 ]
    NP_659404.2. NM_144967.3. [Q6ZRI8-1 ]
    XP_006724792.1. XM_006724729.1. [Q6ZRI8-3 ]
    UniGenei Hs.22905.

    3D structure databases

    ProteinModelPortali Q6ZRI8.
    SMRi Q6ZRI8. Positions 203-426.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127703. 1 interaction.

    PTM databases

    PhosphoSitei Q6ZRI8.

    Polymorphism databases

    DMDMi 74722974.

    Proteomic databases

    PaxDbi Q6ZRI8.
    PRIDEi Q6ZRI8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000276211 ; ENSP00000276211 ; ENSG00000147256 . [Q6ZRI8-1 ]
    ENST00000370921 ; ENSP00000359959 ; ENSG00000147256 . [Q6ZRI8-3 ]
    ENST00000370922 ; ENSP00000359960 ; ENSG00000147256 . [Q6ZRI8-4 ]
    ENST00000412432 ; ENSP00000408515 ; ENSG00000147256 . [Q6ZRI8-2 ]
    GeneIDi 158763.
    KEGGi hsa:158763.
    UCSCi uc004evz.3. human. [Q6ZRI8-1 ]
    uc004ewa.3. human. [Q6ZRI8-4 ]
    uc004ewb.3. human. [Q6ZRI8-2 ]

    Organism-specific databases

    CTDi 158763.
    GeneCardsi GC0XP130192.
    HGNCi HGNC:26388. ARHGAP36.
    HPAi HPA002064.
    neXtProti NX_Q6ZRI8.
    PharmGKBi PA165756384.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG283137.
    HOVERGENi HBG056228.
    InParanoidi Q6ZRI8.
    OMAi SEFKPDR.
    OrthoDBi EOG7FJH1S.
    PhylomeDBi Q6ZRI8.
    TreeFami TF316710.

    Enzyme and pathway databases

    Reactomei REACT_11051. Rho GTPase cycle.

    Miscellaneous databases

    GenomeRNAii 158763.
    NextBioi 87792.
    PROi Q6ZRI8.

    Gene expression databases

    Bgeei Q6ZRI8.
    Genevestigatori Q6ZRI8.

    Family and domain databases

    Gene3Di 1.10.555.10. 2 hits.
    InterProi IPR008936. Rho_GTPase_activation_prot.
    IPR000198. RhoGAP_dom.
    [Graphical view ]
    Pfami PF00620. RhoGAP. 1 hit.
    [Graphical view ]
    SMARTi SM00324. RhoGAP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48350. SSF48350. 1 hit.
    PROSITEi PS50238. RHOGAP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
      Tissue: Adrenal gland, Amygdala, Testis and Tongue.
    2. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: PNS.

    Entry informationi

    Entry nameiRHG36_HUMAN
    AccessioniPrimary (citable) accession number: Q6ZRI8
    Secondary accession number(s): B7Z234
    , B7Z439, Q5JRL9, Q5JRM0, Q5JRM1, Q96NU6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 31, 2006
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 85 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3