Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6ZRI8

- RHG36_HUMAN

UniProt

Q6ZRI8 - RHG36_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Rho GTPase-activating protein 36

Gene

ARHGAP36

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.By similarity

GO - Molecular functioni

  1. GTPase activator activity Source: UniProtKB-KW

GO - Biological processi

  1. regulation of small GTPase mediated signal transduction Source: Reactome
  2. small GTPase mediated signal transduction Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 36
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:26388. ARHGAP36.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165756384.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4040Sequence AnalysisAdd
BLAST
Chaini41 – 547507Rho GTPase-activating protein 36PRO_0000256699Add
BLAST

Proteomic databases

PaxDbiQ6ZRI8.
PRIDEiQ6ZRI8.

PTM databases

PhosphoSiteiQ6ZRI8.

Expressioni

Gene expression databases

BgeeiQ6ZRI8.
ExpressionAtlasiQ6ZRI8. baseline and differential.
GenevestigatoriQ6ZRI8.

Organism-specific databases

HPAiHPA002064.

Interactioni

Protein-protein interaction databases

BioGridi127703. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ6ZRI8.
SMRiQ6ZRI8. Positions 203-426.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini226 – 426201Rho-GAPPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi149 – 18537Arg-richAdd
BLAST

Sequence similaritiesi

Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG283137.
GeneTreeiENSGT00760000119123.
HOVERGENiHBG056228.
InParanoidiQ6ZRI8.
OMAiSEFKPDR.
OrthoDBiEOG7FJH1S.
PhylomeDBiQ6ZRI8.
TreeFamiTF316710.

Family and domain databases

Gene3Di1.10.555.10. 2 hits.
InterProiIPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view]
PfamiPF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
PROSITEiPS50238. RHOGAP. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6ZRI8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGCIPFLKA ARALCPRIMP PLLLLSAFIF LVSVLGGAPG HNPDRRTKMV
60 70 80 90 100
SIHSLSELER LKLQETAYHE LVARHFLSEF KPDRALPIDR PNTLDKWFLI
110 120 130 140 150
LRGQQRAVSH KTFGISLEEV LVNEFTRRKH LELTATMQVE EATGQAAGRR
160 170 180 190 200
RGNVVRRVFG RIRRFFSRRR NEPTLPREFT RRGRRGAVSV DSLAELEDGA
210 220 230 240 250
LLLQTLQLSK ISFPIGQRLL GSKRKMSLNP IAKQIPQVVE ACCQFIEKHG
260 270 280 290 300
LSAVGIFTLE YSVQRVRQLR EEFDQGLDVV LDDNQNVHDV AALLKEFFRD
310 320 330 340 350
MKDSLLPDDL YMSFLLTATL KPQDQLSALQ LLVYLMPPCH SDTLERLLKA
360 370 380 390 400
LHKITENCED SIGIDGQLVP GNRMTSTNLA LVFGSALLKK GKFGKRESRK
410 420 430 440 450
TKLGIDHYVA SVNVVRAMID NWDVLFQVPP HIQRQVAKRV WKSSPEALDF
460 470 480 490 500
IRRRNLRKIQ SARIKMEEDA LLSDPVETSA EARAAVLAQS KPSDEGSSEE
510 520 530 540
PAVPSGTARS HDDEEGAGNP PIPEQDRPLL RVPREKEAKT GVSYFFP
Length:547
Mass (Da):61,664
Last modified:July 5, 2004 - v1
Checksum:i28EB8168F3928DF9
GO
Isoform 2 (identifier: Q6ZRI8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGGCIPFLKAARALCPRIMPPLLLLSAFIFLV → M

Show »
Length:516
Mass (Da):58,340
Checksum:i15B94C6E4A812CD8
GO
Isoform 3 (identifier: Q6ZRI8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: Missing.

Note: No experimental confirmation available.

Show »
Length:411
Mass (Da):46,230
Checksum:i58C7DFD0D4CE3822
GO
Isoform 4 (identifier: Q6ZRI8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MGGCIPFLKAARALCPRIMPPLLLLSAFIFL → MAWILDCLFASAFEPRPRR

Note: No experimental confirmation available.

Show »
Length:535
Mass (Da):60,570
Checksum:iA2B54A40702F287F
GO
Isoform 5 (identifier: Q6ZRI8-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: Missing.

Note: No experimental confirmation available.

Show »
Length:499
Mass (Da):56,565
Checksum:i0D1D47E6A5A25B29
GO

Sequence cautioni

The sequence AAH63790.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAI41400.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti340 – 3401H → R in BAH12425. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 136136Missing in isoform 3. 1 PublicationVSP_021357Add
BLAST
Alternative sequencei1 – 4848Missing in isoform 5. 1 PublicationVSP_039235Add
BLAST
Alternative sequencei1 – 3232MGGCI…FIFLV → M in isoform 2. 1 PublicationVSP_021358Add
BLAST
Alternative sequencei1 – 3131MGGCI…AFIFL → MAWILDCLFASAFEPRPRR in isoform 4. 1 PublicationVSP_039236Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK054620 mRNA. Translation: BAB70776.1.
AK128203 mRNA. Translation: BAC87322.1.
AK294274 mRNA. Translation: BAH11720.1.
AK296748 mRNA. Translation: BAH12425.1.
AL590131 Genomic DNA. Translation: CAI41399.1.
AL590131 Genomic DNA. Translation: CAI41400.1. Different initiation.
AL590131 Genomic DNA. Translation: CAI41401.1.
AL590131 Genomic DNA. Translation: CAI41398.1.
CH471107 Genomic DNA. Translation: EAX11793.1.
BC063790 mRNA. Translation: AAH63790.1. Different initiation.
CCDSiCCDS14628.1. [Q6ZRI8-1]
CCDS65320.1. [Q6ZRI8-4]
RefSeqiNP_001269536.1. NM_001282607.1. [Q6ZRI8-4]
NP_659404.2. NM_144967.3. [Q6ZRI8-1]
XP_006724792.1. XM_006724729.1. [Q6ZRI8-3]
UniGeneiHs.22905.

Genome annotation databases

EnsembliENST00000276211; ENSP00000276211; ENSG00000147256. [Q6ZRI8-1]
ENST00000370921; ENSP00000359959; ENSG00000147256. [Q6ZRI8-3]
ENST00000370922; ENSP00000359960; ENSG00000147256. [Q6ZRI8-4]
ENST00000412432; ENSP00000408515; ENSG00000147256. [Q6ZRI8-2]
GeneIDi158763.
KEGGihsa:158763.
UCSCiuc004evz.3. human. [Q6ZRI8-1]
uc004ewa.3. human. [Q6ZRI8-4]
uc004ewb.3. human. [Q6ZRI8-2]

Polymorphism databases

DMDMi74722974.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK054620 mRNA. Translation: BAB70776.1 .
AK128203 mRNA. Translation: BAC87322.1 .
AK294274 mRNA. Translation: BAH11720.1 .
AK296748 mRNA. Translation: BAH12425.1 .
AL590131 Genomic DNA. Translation: CAI41399.1 .
AL590131 Genomic DNA. Translation: CAI41400.1 . Different initiation.
AL590131 Genomic DNA. Translation: CAI41401.1 .
AL590131 Genomic DNA. Translation: CAI41398.1 .
CH471107 Genomic DNA. Translation: EAX11793.1 .
BC063790 mRNA. Translation: AAH63790.1 . Different initiation.
CCDSi CCDS14628.1. [Q6ZRI8-1 ]
CCDS65320.1. [Q6ZRI8-4 ]
RefSeqi NP_001269536.1. NM_001282607.1. [Q6ZRI8-4 ]
NP_659404.2. NM_144967.3. [Q6ZRI8-1 ]
XP_006724792.1. XM_006724729.1. [Q6ZRI8-3 ]
UniGenei Hs.22905.

3D structure databases

ProteinModelPortali Q6ZRI8.
SMRi Q6ZRI8. Positions 203-426.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127703. 1 interaction.

PTM databases

PhosphoSitei Q6ZRI8.

Polymorphism databases

DMDMi 74722974.

Proteomic databases

PaxDbi Q6ZRI8.
PRIDEi Q6ZRI8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000276211 ; ENSP00000276211 ; ENSG00000147256 . [Q6ZRI8-1 ]
ENST00000370921 ; ENSP00000359959 ; ENSG00000147256 . [Q6ZRI8-3 ]
ENST00000370922 ; ENSP00000359960 ; ENSG00000147256 . [Q6ZRI8-4 ]
ENST00000412432 ; ENSP00000408515 ; ENSG00000147256 . [Q6ZRI8-2 ]
GeneIDi 158763.
KEGGi hsa:158763.
UCSCi uc004evz.3. human. [Q6ZRI8-1 ]
uc004ewa.3. human. [Q6ZRI8-4 ]
uc004ewb.3. human. [Q6ZRI8-2 ]

Organism-specific databases

CTDi 158763.
GeneCardsi GC0XP130192.
HGNCi HGNC:26388. ARHGAP36.
HPAi HPA002064.
neXtProti NX_Q6ZRI8.
PharmGKBi PA165756384.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG283137.
GeneTreei ENSGT00760000119123.
HOVERGENi HBG056228.
InParanoidi Q6ZRI8.
OMAi SEFKPDR.
OrthoDBi EOG7FJH1S.
PhylomeDBi Q6ZRI8.
TreeFami TF316710.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.

Miscellaneous databases

GenomeRNAii 158763.
NextBioi 87792.
PROi Q6ZRI8.

Gene expression databases

Bgeei Q6ZRI8.
ExpressionAtlasi Q6ZRI8. baseline and differential.
Genevestigatori Q6ZRI8.

Family and domain databases

Gene3Di 1.10.555.10. 2 hits.
InterProi IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
[Graphical view ]
Pfami PF00620. RhoGAP. 1 hit.
[Graphical view ]
SMARTi SM00324. RhoGAP. 1 hit.
[Graphical view ]
SUPFAMi SSF48350. SSF48350. 1 hit.
PROSITEi PS50238. RHOGAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
    Tissue: Adrenal gland, Amygdala, Testis and Tongue.
  2. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: PNS.

Entry informationi

Entry nameiRHG36_HUMAN
AccessioniPrimary (citable) accession number: Q6ZRI8
Secondary accession number(s): B7Z234
, B7Z439, Q5JRL9, Q5JRM0, Q5JRM1, Q96NU6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: July 5, 2004
Last modified: October 29, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3