Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6ZQQ6

- WDR87_HUMAN

UniProt

Q6ZQQ6 - WDR87_HUMAN

Protein

WD repeat-containing protein 87

Gene

WDR87

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 89 (01 Oct 2014)
      Sequence version 3 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Enzyme and pathway databases

    SignaLinkiQ6ZQQ6.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    WD repeat-containing protein 87
    Alternative name(s):
    Testis development protein NYD-SP11
    Gene namesi
    Name:WDR87
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:29934. WDR87.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA145147633.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 28732873WD repeat-containing protein 87PRO_0000314821Add
    BLAST

    Proteomic databases

    PaxDbiQ6ZQQ6.
    PRIDEiQ6ZQQ6.

    PTM databases

    PhosphoSiteiQ6ZQQ6.

    Expressioni

    Gene expression databases

    ArrayExpressiQ6ZQQ6.
    BgeeiQ6ZQQ6.
    CleanExiHS_WDR87.
    GenevestigatoriQ6ZQQ6.

    Organism-specific databases

    HPAiHPA048269.
    HPA049455.

    Interactioni

    Protein-protein interaction databases

    BioGridi123800. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6ZQQ6.
    SMRiQ6ZQQ6. Positions 87-125, 198-275, 582-619.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati108 – 14639WD 1Add
    BLAST
    Repeati199 – 23941WD 2Add
    BLAST
    Repeati242 – 28342WD 3Add
    BLAST
    Repeati368 – 40740WD 4Add
    BLAST
    Repeati415 – 46046WD 5Add
    BLAST
    Repeati516 – 55338WD 6Add
    BLAST
    Repeati565 – 60440WD 7Add
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1419 – 2347929Glu-richAdd
    BLAST

    Sequence similaritiesi

    Contains 7 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    eggNOGiNOG129648.
    HOGENOMiHOG000169123.
    InParanoidiQ6ZQQ6.
    TreeFamiTF338139.

    Family and domain databases

    Gene3Di2.130.10.10. 4 hits.
    InterProiIPR011047. Quinonprotein_ADH-like_supfam.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF00400. WD40. 2 hits.
    [Graphical view]
    SMARTiSM00320. WD40. 4 hits.
    [Graphical view]
    SUPFAMiSSF50998. SSF50998. 2 hits.
    PROSITEiPS50082. WD_REPEATS_2. 2 hits.
    PS50294. WD_REPEATS_REGION. 2 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6ZQQ6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSPRLIPLW KDLKLLLNDT INKSKQPSED PKNCLIVLSD RSQAVAWMKS     50
    KTEDMVEKRT FSMTERLPPI QSMVHAGSFH ILVVYCGDLI LRLFGDHFRA 100
    FKPLGKVPCR FNISCLCYDP EMKMLLSGIL GAVVTWVIEL GGTGLQIAHM 150
    VSMPGDELVQ DIVLNGPSGS LLALCETVVR VLMHQGKGQL GEVKRFTSTS 200
    SGSSITCCFT CFDQGFLYAG NQAGEIQVWS LQQGHPLHSF QAHQSGVICI 250
    RSRPEAHTLL TAGSDSLIKE WNLTSGSLLR RLELGEELYR LQFIDSITFF 300
    CQTAHSFSLH RLPCFYSLFN VCGSAPQQLR RVCCGNNWFR ILCTTEDGLL 350
    RFVSPVTGDL LVITWPFSIL DQAVDWAYDP GKEELFVATG SSEVLVFDTT 400
    RCPCPAKYLL GTSPNSQDFV QCLAYGHFNL GRGLEGLIFS GHQSGVIRVL 450
    SQHSCARLEK FMHFGAVLAL STLSGGIFGG QGNSLLCSYG MDDYVHLSEA 500
    VLDGVKVQLR PLASILSSCH LTHLILLPKS VGAITETNCL RLWKFHDFLS 550
    SGSQNGLKFI ETLPLHLCAI TSFDVCLSLS LFVTGSADGS VRIWDFHGRL 600
    IGILDSSLHF GPVCFANDRG DLLVTFNQSL YLVSCLKLLP PALLTRLSFM 650
    SISDEVLEVP KPFIPSFFFS FETMFVPKYI YPGQAQQKLV GLEKLVNNRA 700
    IAFDHSVPHV IEEDEEGSPV LLRSSMHYSL QDMEDWMQVS KRYQCHYVLP 750
    PQLQLTSWDG LNPYQILRYY FGHGREWLFA PDCYIPNSVI RARLWPEGTP 800
    IYLQCNLHAP QRELEWDRSQ EFFFWHSRVR AISNTEYPKN KEEDEHFLEM 850
    RLSKDVTYSV LTDGANRSWL GRKMSEITIN SMIETMLNIM VHASLLKYQC 900
    CVGALGQIFA SYQVSPALRS ETARRLLNDT TNSNPLIREL AWEGLKRLGM 950
    ITHLFAMPLA QGLMDKDERV RIKTLSLMAE IGIHSRTSLL QLTQKQETFR 1000
    EMQQQMIGEE PLDHLLGMRA TDLQILSTQV EQRLNENLTL SHRDEKPAFS 1050
    LDVSMPSELK SSLKPPTVSE ESEVAIKPSK GQRRGQAGVK KHSQKWLRGL 1100
    KKTKERDSKQ MSTEPGLLED ESGTEAAPIE MEEASVYSQW SSSTSVIKLS 1150
    KDVDSQEKDI SKDHIALTLK RLQKIRDKRD KKATAQKLKK KHKKKGKEAK 1200
    VINEETTPPV MEQPVTKKVK IQGRGASGIS GRRSTAGDGS SWRDDLCRLM 1250
    ALRISGSQTK MSENLNAELV TFAQEMLVDR HPSWELFQEI CPLLKKESKV 1300
    LLEDLDWDVV PPEKKPIFIQ EGAIREDMIQ GVTQEVIRHK EVMPREEEQA 1350
    QKKARDMLGL EETQVILKKG KKVIFLEPGN VTMGKEISKK EEKKTFQKSP 1400
    KQGRKAVQKE RKVGKIKREM TKEERDMSEE VEEMATLEEK VVKQEGKLVM 1450
    IERTPSWQDW KKAWDEWKQV HGETRKSWKA WKEEWEKRLL QEEEKLHQAG 1500
    EKLSPEEEML QEDKKLKWEE WKQVWENMLS SKSKEQQYKD EEEVTLEEEV 1550
    SREGEEKEQQ VTEEQRHIQE EHKWARIHRK RARAEKKRAQ EERKLAQEEE 1600
    KLAQEERQLA QEERKLAQAY VKITQDDREM AQAEGKFAQK EETLAQRGEK 1650
    LSQEAEKLAQ KRKKLAKKWE KVAREEEKLA KKGGKLAEVK NILAQKVEEL 1700
    PQREQNLDWQ EKELAQELEE LEWDMEELSW KEEELNQEEG KLVEEKKKLA 1750
    EEEEALAWQR EKLSEEETKL AQEEELLIQE KEKLAQHKEK MPEEEERLGR 1800
    KREQLIEKKM KLAQKRERWI NSMEELTKNK MILYQKKNLA QEKKNLAQEK 1850
    EKLAQRKENL LYNKERLTHS KKQLVQVKNK LGMFNKILAQ VEEKLTQEKE 1900
    TVIKKKEKLA ETEKKLVQVE DSLAKKQEKL AQEKMKLALE KAMVQGKKRL 1950
    RGELDIAKEE KALNLEMKRL AEEKMRLVEG KETLSKGETP ETSRQRKMTQ 2000
    VEQELFERKL SLEEKILLHE DRILAMEESE IAKGKLEFTR GQRIFVQGQR 2050
    KLAKASRKLI KKRESLSKEP AKLNKILKAL QKLTRDERKL TQEEIKMTKM 2100
    KRALFVKERR LSIEQSKLDI KEWDFSEKRS ELTKDEKKLA RKQRKLANKM 2150
    RRMINKEEKM TEEESKLARK HSEVILDDEE EGGIEEEEVI PFLKRRWRKR 2200
    KEAKRGDKPK EKFSSQVDEV ESEEHFSEEM ESLLDELEKQ ESLSSEEEEE 2250
    REEEEEREEE EVREEEEERK EEEEGEEKQV EKEEEEKKKK KKEKKKEEVQ 2300
    EKEEVFEEKE EIMSEEETES LSDEEEEEES CSLEEEVDRE KEILKKEKQF 2350
    KLQEQRRKSL RGRERVLSIL RGVPHGKGRA IRLGVLKSPL KKLMSTALEM 2400
    KEKTPVPVPE KQISWEDKKA TVVEIPRKFL GTMDKEREVM GKYEPIPPHV 2450
    LGTVLESQAQ DLKTPFMSHI LRRTVEAEEL QHKPLGAWWK WFLQHPPLMG 2500
    QTEVQLPLSQ IPAKEQHADV SLSDVEWIRH VLERMEAGEQ LSRDGFHRLC 2550
    QLLKDLASKG NLEWLHLAKH EAIVYRHRQA LESQDTRISS RQSMSPKYLK 2600
    VIPPIKAKEK ESWPKPLAVP TQKSPLATKR IPDPRAKNWH LLGEPYRSER 2650
    AQQISIAHKE MEMQYFYPAT RDIFPSAHAS VEKQTLALMF QKDFWDFKDK 2700
    RRFPKLPKLE KKTQPISKKK EELPLWETFV ALYHVLRMLQ QRYPKDSTAW 2750
    MEQFYQLMDL YQLKSPRIQK LLQELLMREE PQPQEIIYEE ALKATELVPG 2800
    ERLFCCLFCG SSHTPRSPQE FQGAVPLPWQ NCVRTILPVG IARYGILELA 2850
    WKSLPEADLH LTKALTHTVA PTL 2873
    Length:2,873
    Mass (Da):333,185
    Last modified:May 18, 2010 - v3
    Checksum:iE4BC3A63C503BAB4
    GO
    Isoform 2 (identifier: Q6ZQQ6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         42-42: S → SQALFKESRYPQNMPCVCYYFSDAHFFASLSWVTSNTKEI

    Note: No experimental confirmation available.

    Show »
    Length:2,912
    Mass (Da):337,777
    Checksum:iF92E39FC2179E241
    GO

    Sequence cautioni

    The sequence AAK20167.2 differs from that shown. Reason: Frameshift at positions 126, 820, 1129 and 1140.
    The sequence AAK20167.2 differs from that shown. Reason: Erroneous termination at position 825. Translated as Trp.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti135 – 1351T → S in AAK20167. 1 PublicationCurated
    Sequence conflicti177 – 1771T → A in BAC87627. (PubMed:14702039)Curated
    Sequence conflicti226 – 2261I → T in AAK20167. 1 PublicationCurated
    Sequence conflicti529 – 5291K → Q in AAK20167. 1 PublicationCurated
    Sequence conflicti602 – 6021G → A in BAC87627. (PubMed:14702039)Curated
    Sequence conflicti602 – 6021G → A in AAK20167. 1 PublicationCurated
    Sequence conflicti817 – 8182DR → NS in AAK20167. 1 PublicationCurated
    Sequence conflicti821 – 8211E → G in AAK20167. 1 PublicationCurated
    Sequence conflicti939 – 9391E → G in AAK20167. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti496 – 4961H → Y.
    Corresponds to variant rs12104280 [ dbSNP | Ensembl ].
    VAR_057638
    Natural varianti1583 – 15831R → Q.
    Corresponds to variant rs6508750 [ dbSNP | Ensembl ].
    VAR_057639
    Natural varianti1885 – 18851N → K.
    Corresponds to variant rs10422056 [ dbSNP | Ensembl ].
    VAR_057640
    Natural varianti2570 – 25701H → L.
    Corresponds to variant rs10408510 [ dbSNP | Ensembl ].
    VAR_057641

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei42 – 421S → SQALFKESRYPQNMPCVCYY FSDAHFFASLSWVTSNTKEI in isoform 2. 1 PublicationVSP_030380

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC016582 Genomic DNA. No translation available.
    AK128826 mRNA. Translation: BAC87627.1.
    AY026504 mRNA. Translation: AAK20167.2. Sequence problems.
    CCDSiCCDS46063.1. [Q6ZQQ6-1]
    RefSeqiNP_114157.4. NM_031951.4.
    UniGeneiHs.664194.

    Genome annotation databases

    EnsembliENST00000303868; ENSP00000368025; ENSG00000171804. [Q6ZQQ6-1]
    GeneIDi83889.
    UCSCiuc010efu.2. human. [Q6ZQQ6-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC016582 Genomic DNA. No translation available.
    AK128826 mRNA. Translation: BAC87627.1 .
    AY026504 mRNA. Translation: AAK20167.2 . Sequence problems.
    CCDSi CCDS46063.1. [Q6ZQQ6-1 ]
    RefSeqi NP_114157.4. NM_031951.4.
    UniGenei Hs.664194.

    3D structure databases

    ProteinModelPortali Q6ZQQ6.
    SMRi Q6ZQQ6. Positions 87-125, 198-275, 582-619.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123800. 1 interaction.

    PTM databases

    PhosphoSitei Q6ZQQ6.

    Proteomic databases

    PaxDbi Q6ZQQ6.
    PRIDEi Q6ZQQ6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000303868 ; ENSP00000368025 ; ENSG00000171804 . [Q6ZQQ6-1 ]
    GeneIDi 83889.
    UCSCi uc010efu.2. human. [Q6ZQQ6-1 ]

    Organism-specific databases

    GeneCardsi GC19M038376.
    HGNCi HGNC:29934. WDR87.
    HPAi HPA048269.
    HPA049455.
    neXtProti NX_Q6ZQQ6.
    PharmGKBi PA145147633.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG129648.
    HOGENOMi HOG000169123.
    InParanoidi Q6ZQQ6.
    TreeFami TF338139.

    Enzyme and pathway databases

    SignaLinki Q6ZQQ6.

    Miscellaneous databases

    GenomeRNAii 83889.
    NextBioi 72969.
    PROi Q6ZQQ6.

    Gene expression databases

    ArrayExpressi Q6ZQQ6.
    Bgeei Q6ZQQ6.
    CleanExi HS_WDR87.
    Genevestigatori Q6ZQQ6.

    Family and domain databases

    Gene3Di 2.130.10.10. 4 hits.
    InterProi IPR011047. Quinonprotein_ADH-like_supfam.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF00400. WD40. 2 hits.
    [Graphical view ]
    SMARTi SM00320. WD40. 4 hits.
    [Graphical view ]
    SUPFAMi SSF50998. SSF50998. 2 hits.
    PROSITEi PS50082. WD_REPEATS_2. 2 hits.
    PS50294. WD_REPEATS_REGION. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1350 (ISOFORM 1).
      Tissue: Testis.
    3. "Cloning of new testis gene (NYD-SP11) related to testis development from human testis cDNA library."
      Sha J.H.
      Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-1170 (ISOFORM 2).
      Tissue: Testis.
    4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiWDR87_HUMAN
    AccessioniPrimary (citable) accession number: Q6ZQQ6
    Secondary accession number(s): Q9BWV9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 15, 2008
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 89 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3