Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6ZQQ6

- WDR87_HUMAN

UniProt

Q6ZQQ6 - WDR87_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

WD repeat-containing protein 87

Gene

WDR87

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ6ZQQ6.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 87
Alternative name(s):
Testis development protein NYD-SP11
Gene namesi
Name:WDR87
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:29934. WDR87.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145147633.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 28732873WD repeat-containing protein 87PRO_0000314821Add
BLAST

Proteomic databases

PaxDbiQ6ZQQ6.
PRIDEiQ6ZQQ6.

PTM databases

PhosphoSiteiQ6ZQQ6.

Expressioni

Gene expression databases

BgeeiQ6ZQQ6.
CleanExiHS_WDR87.
ExpressionAtlasiQ6ZQQ6. baseline.
GenevestigatoriQ6ZQQ6.

Organism-specific databases

HPAiHPA048269.
HPA049455.

Interactioni

Protein-protein interaction databases

BioGridi123800. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ6ZQQ6.
SMRiQ6ZQQ6. Positions 217-273, 565-625.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati108 – 14639WD 1Add
BLAST
Repeati199 – 23941WD 2Add
BLAST
Repeati242 – 28342WD 3Add
BLAST
Repeati368 – 40740WD 4Add
BLAST
Repeati415 – 46046WD 5Add
BLAST
Repeati516 – 55338WD 6Add
BLAST
Repeati565 – 60440WD 7Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1419 – 2347929Glu-richAdd
BLAST

Sequence similaritiesi

Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiNOG129648.
HOGENOMiHOG000169123.
InParanoidiQ6ZQQ6.
TreeFamiTF338139.

Family and domain databases

Gene3Di2.130.10.10. 4 hits.
InterProiIPR011047. Quinonprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 2 hits.
[Graphical view]
SMARTiSM00320. WD40. 4 hits.
[Graphical view]
SUPFAMiSSF50998. SSF50998. 2 hits.
PROSITEiPS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6ZQQ6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSPRLIPLW KDLKLLLNDT INKSKQPSED PKNCLIVLSD RSQAVAWMKS
60 70 80 90 100
KTEDMVEKRT FSMTERLPPI QSMVHAGSFH ILVVYCGDLI LRLFGDHFRA
110 120 130 140 150
FKPLGKVPCR FNISCLCYDP EMKMLLSGIL GAVVTWVIEL GGTGLQIAHM
160 170 180 190 200
VSMPGDELVQ DIVLNGPSGS LLALCETVVR VLMHQGKGQL GEVKRFTSTS
210 220 230 240 250
SGSSITCCFT CFDQGFLYAG NQAGEIQVWS LQQGHPLHSF QAHQSGVICI
260 270 280 290 300
RSRPEAHTLL TAGSDSLIKE WNLTSGSLLR RLELGEELYR LQFIDSITFF
310 320 330 340 350
CQTAHSFSLH RLPCFYSLFN VCGSAPQQLR RVCCGNNWFR ILCTTEDGLL
360 370 380 390 400
RFVSPVTGDL LVITWPFSIL DQAVDWAYDP GKEELFVATG SSEVLVFDTT
410 420 430 440 450
RCPCPAKYLL GTSPNSQDFV QCLAYGHFNL GRGLEGLIFS GHQSGVIRVL
460 470 480 490 500
SQHSCARLEK FMHFGAVLAL STLSGGIFGG QGNSLLCSYG MDDYVHLSEA
510 520 530 540 550
VLDGVKVQLR PLASILSSCH LTHLILLPKS VGAITETNCL RLWKFHDFLS
560 570 580 590 600
SGSQNGLKFI ETLPLHLCAI TSFDVCLSLS LFVTGSADGS VRIWDFHGRL
610 620 630 640 650
IGILDSSLHF GPVCFANDRG DLLVTFNQSL YLVSCLKLLP PALLTRLSFM
660 670 680 690 700
SISDEVLEVP KPFIPSFFFS FETMFVPKYI YPGQAQQKLV GLEKLVNNRA
710 720 730 740 750
IAFDHSVPHV IEEDEEGSPV LLRSSMHYSL QDMEDWMQVS KRYQCHYVLP
760 770 780 790 800
PQLQLTSWDG LNPYQILRYY FGHGREWLFA PDCYIPNSVI RARLWPEGTP
810 820 830 840 850
IYLQCNLHAP QRELEWDRSQ EFFFWHSRVR AISNTEYPKN KEEDEHFLEM
860 870 880 890 900
RLSKDVTYSV LTDGANRSWL GRKMSEITIN SMIETMLNIM VHASLLKYQC
910 920 930 940 950
CVGALGQIFA SYQVSPALRS ETARRLLNDT TNSNPLIREL AWEGLKRLGM
960 970 980 990 1000
ITHLFAMPLA QGLMDKDERV RIKTLSLMAE IGIHSRTSLL QLTQKQETFR
1010 1020 1030 1040 1050
EMQQQMIGEE PLDHLLGMRA TDLQILSTQV EQRLNENLTL SHRDEKPAFS
1060 1070 1080 1090 1100
LDVSMPSELK SSLKPPTVSE ESEVAIKPSK GQRRGQAGVK KHSQKWLRGL
1110 1120 1130 1140 1150
KKTKERDSKQ MSTEPGLLED ESGTEAAPIE MEEASVYSQW SSSTSVIKLS
1160 1170 1180 1190 1200
KDVDSQEKDI SKDHIALTLK RLQKIRDKRD KKATAQKLKK KHKKKGKEAK
1210 1220 1230 1240 1250
VINEETTPPV MEQPVTKKVK IQGRGASGIS GRRSTAGDGS SWRDDLCRLM
1260 1270 1280 1290 1300
ALRISGSQTK MSENLNAELV TFAQEMLVDR HPSWELFQEI CPLLKKESKV
1310 1320 1330 1340 1350
LLEDLDWDVV PPEKKPIFIQ EGAIREDMIQ GVTQEVIRHK EVMPREEEQA
1360 1370 1380 1390 1400
QKKARDMLGL EETQVILKKG KKVIFLEPGN VTMGKEISKK EEKKTFQKSP
1410 1420 1430 1440 1450
KQGRKAVQKE RKVGKIKREM TKEERDMSEE VEEMATLEEK VVKQEGKLVM
1460 1470 1480 1490 1500
IERTPSWQDW KKAWDEWKQV HGETRKSWKA WKEEWEKRLL QEEEKLHQAG
1510 1520 1530 1540 1550
EKLSPEEEML QEDKKLKWEE WKQVWENMLS SKSKEQQYKD EEEVTLEEEV
1560 1570 1580 1590 1600
SREGEEKEQQ VTEEQRHIQE EHKWARIHRK RARAEKKRAQ EERKLAQEEE
1610 1620 1630 1640 1650
KLAQEERQLA QEERKLAQAY VKITQDDREM AQAEGKFAQK EETLAQRGEK
1660 1670 1680 1690 1700
LSQEAEKLAQ KRKKLAKKWE KVAREEEKLA KKGGKLAEVK NILAQKVEEL
1710 1720 1730 1740 1750
PQREQNLDWQ EKELAQELEE LEWDMEELSW KEEELNQEEG KLVEEKKKLA
1760 1770 1780 1790 1800
EEEEALAWQR EKLSEEETKL AQEEELLIQE KEKLAQHKEK MPEEEERLGR
1810 1820 1830 1840 1850
KREQLIEKKM KLAQKRERWI NSMEELTKNK MILYQKKNLA QEKKNLAQEK
1860 1870 1880 1890 1900
EKLAQRKENL LYNKERLTHS KKQLVQVKNK LGMFNKILAQ VEEKLTQEKE
1910 1920 1930 1940 1950
TVIKKKEKLA ETEKKLVQVE DSLAKKQEKL AQEKMKLALE KAMVQGKKRL
1960 1970 1980 1990 2000
RGELDIAKEE KALNLEMKRL AEEKMRLVEG KETLSKGETP ETSRQRKMTQ
2010 2020 2030 2040 2050
VEQELFERKL SLEEKILLHE DRILAMEESE IAKGKLEFTR GQRIFVQGQR
2060 2070 2080 2090 2100
KLAKASRKLI KKRESLSKEP AKLNKILKAL QKLTRDERKL TQEEIKMTKM
2110 2120 2130 2140 2150
KRALFVKERR LSIEQSKLDI KEWDFSEKRS ELTKDEKKLA RKQRKLANKM
2160 2170 2180 2190 2200
RRMINKEEKM TEEESKLARK HSEVILDDEE EGGIEEEEVI PFLKRRWRKR
2210 2220 2230 2240 2250
KEAKRGDKPK EKFSSQVDEV ESEEHFSEEM ESLLDELEKQ ESLSSEEEEE
2260 2270 2280 2290 2300
REEEEEREEE EVREEEEERK EEEEGEEKQV EKEEEEKKKK KKEKKKEEVQ
2310 2320 2330 2340 2350
EKEEVFEEKE EIMSEEETES LSDEEEEEES CSLEEEVDRE KEILKKEKQF
2360 2370 2380 2390 2400
KLQEQRRKSL RGRERVLSIL RGVPHGKGRA IRLGVLKSPL KKLMSTALEM
2410 2420 2430 2440 2450
KEKTPVPVPE KQISWEDKKA TVVEIPRKFL GTMDKEREVM GKYEPIPPHV
2460 2470 2480 2490 2500
LGTVLESQAQ DLKTPFMSHI LRRTVEAEEL QHKPLGAWWK WFLQHPPLMG
2510 2520 2530 2540 2550
QTEVQLPLSQ IPAKEQHADV SLSDVEWIRH VLERMEAGEQ LSRDGFHRLC
2560 2570 2580 2590 2600
QLLKDLASKG NLEWLHLAKH EAIVYRHRQA LESQDTRISS RQSMSPKYLK
2610 2620 2630 2640 2650
VIPPIKAKEK ESWPKPLAVP TQKSPLATKR IPDPRAKNWH LLGEPYRSER
2660 2670 2680 2690 2700
AQQISIAHKE MEMQYFYPAT RDIFPSAHAS VEKQTLALMF QKDFWDFKDK
2710 2720 2730 2740 2750
RRFPKLPKLE KKTQPISKKK EELPLWETFV ALYHVLRMLQ QRYPKDSTAW
2760 2770 2780 2790 2800
MEQFYQLMDL YQLKSPRIQK LLQELLMREE PQPQEIIYEE ALKATELVPG
2810 2820 2830 2840 2850
ERLFCCLFCG SSHTPRSPQE FQGAVPLPWQ NCVRTILPVG IARYGILELA
2860 2870
WKSLPEADLH LTKALTHTVA PTL
Length:2,873
Mass (Da):333,185
Last modified:May 18, 2010 - v3
Checksum:iE4BC3A63C503BAB4
GO
Isoform 2 (identifier: Q6ZQQ6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-42: S → SQALFKESRYPQNMPCVCYYFSDAHFFASLSWVTSNTKEI

Note: No experimental confirmation available.

Show »
Length:2,912
Mass (Da):337,777
Checksum:iF92E39FC2179E241
GO

Sequence cautioni

The sequence AAK20167.2 differs from that shown. Reason: Frameshift at positions 126, 820, 1129 and 1140.
The sequence AAK20167.2 differs from that shown. Reason: Erroneous termination at position 825. Translated as Trp.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti135 – 1351T → S in AAK20167. 1 PublicationCurated
Sequence conflicti177 – 1771T → A in BAC87627. (PubMed:14702039)Curated
Sequence conflicti226 – 2261I → T in AAK20167. 1 PublicationCurated
Sequence conflicti529 – 5291K → Q in AAK20167. 1 PublicationCurated
Sequence conflicti602 – 6021G → A in BAC87627. (PubMed:14702039)Curated
Sequence conflicti602 – 6021G → A in AAK20167. 1 PublicationCurated
Sequence conflicti817 – 8182DR → NS in AAK20167. 1 PublicationCurated
Sequence conflicti821 – 8211E → G in AAK20167. 1 PublicationCurated
Sequence conflicti939 – 9391E → G in AAK20167. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti496 – 4961H → Y.
Corresponds to variant rs12104280 [ dbSNP | Ensembl ].
VAR_057638
Natural varianti1583 – 15831R → Q.
Corresponds to variant rs6508750 [ dbSNP | Ensembl ].
VAR_057639
Natural varianti1885 – 18851N → K.
Corresponds to variant rs10422056 [ dbSNP | Ensembl ].
VAR_057640
Natural varianti2570 – 25701H → L.
Corresponds to variant rs10408510 [ dbSNP | Ensembl ].
VAR_057641

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei42 – 421S → SQALFKESRYPQNMPCVCYY FSDAHFFASLSWVTSNTKEI in isoform 2. 1 PublicationVSP_030380

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC016582 Genomic DNA. No translation available.
AK128826 mRNA. Translation: BAC87627.1.
AY026504 mRNA. Translation: AAK20167.2. Sequence problems.
CCDSiCCDS46063.1. [Q6ZQQ6-1]
CCDS74356.1. [Q6ZQQ6-2]
RefSeqiNP_114157.4. NM_031951.4.
UniGeneiHs.664194.

Genome annotation databases

EnsembliENST00000303868; ENSP00000368025; ENSG00000171804.
GeneIDi83889.
UCSCiuc010efu.2. human. [Q6ZQQ6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC016582 Genomic DNA. No translation available.
AK128826 mRNA. Translation: BAC87627.1 .
AY026504 mRNA. Translation: AAK20167.2 . Sequence problems.
CCDSi CCDS46063.1. [Q6ZQQ6-1 ]
CCDS74356.1. [Q6ZQQ6-2 ]
RefSeqi NP_114157.4. NM_031951.4.
UniGenei Hs.664194.

3D structure databases

ProteinModelPortali Q6ZQQ6.
SMRi Q6ZQQ6. Positions 217-273, 565-625.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123800. 1 interaction.

PTM databases

PhosphoSitei Q6ZQQ6.

Proteomic databases

PaxDbi Q6ZQQ6.
PRIDEi Q6ZQQ6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000303868 ; ENSP00000368025 ; ENSG00000171804 .
GeneIDi 83889.
UCSCi uc010efu.2. human. [Q6ZQQ6-1 ]

Organism-specific databases

CTDi 83889.
GeneCardsi GC19M038376.
HGNCi HGNC:29934. WDR87.
HPAi HPA048269.
HPA049455.
neXtProti NX_Q6ZQQ6.
PharmGKBi PA145147633.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG129648.
HOGENOMi HOG000169123.
InParanoidi Q6ZQQ6.
TreeFami TF338139.

Enzyme and pathway databases

SignaLinki Q6ZQQ6.

Miscellaneous databases

NextBioi 72969.
PROi Q6ZQQ6.

Gene expression databases

Bgeei Q6ZQQ6.
CleanExi HS_WDR87.
ExpressionAtlasi Q6ZQQ6. baseline.
Genevestigatori Q6ZQQ6.

Family and domain databases

Gene3Di 2.130.10.10. 4 hits.
InterProi IPR011047. Quinonprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF00400. WD40. 2 hits.
[Graphical view ]
SMARTi SM00320. WD40. 4 hits.
[Graphical view ]
SUPFAMi SSF50998. SSF50998. 2 hits.
PROSITEi PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1350 (ISOFORM 1).
    Tissue: Testis.
  3. "Cloning of new testis gene (NYD-SP11) related to testis development from human testis cDNA library."
    Sha J.H.
    Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-1170 (ISOFORM 2).
    Tissue: Testis.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiWDR87_HUMAN
AccessioniPrimary (citable) accession number: Q6ZQQ6
Secondary accession number(s): Q9BWV9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 18, 2010
Last modified: October 29, 2014
This is version 90 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3