Q6ZQQ6 (WDR87_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 77.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: WD repeat-containing protein 87 Alternative name(s): Testis development protein NYD-SP11 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2873 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Contains 7 WD repeats. |
| Sequence caution | The sequence AAK20167.2 differs from that shown. Reason: Erroneous termination at position 825. Translated as Trp. The sequence AAK20167.2 differs from that shown. Reason: Frameshift at positions 126, 820, 1129 and 1140. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat WD repeat |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6ZQQ6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6ZQQ6-2) The sequence of this isoform differs from the canonical sequence as follows: 42-42: S → SQALFKESRYPQNMPCVCYYFSDAHFFASLSWVTSNTKEI | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2873 | 2873 | WD repeat-containing protein 87 | PRO_0000314821 | |||||
Regions | |||||||||
| Repeat | 108 – 146 | 39 | WD 1 | ||||||
| Repeat | 199 – 239 | 41 | WD 2 | ||||||
| Repeat | 242 – 283 | 42 | WD 3 | ||||||
| Repeat | 368 – 407 | 40 | WD 4 | ||||||
| Repeat | 415 – 460 | 46 | WD 5 | ||||||
| Repeat | 516 – 553 | 38 | WD 6 | ||||||
| Repeat | 565 – 604 | 40 | WD 7 | ||||||
| Compositional bias | 1419 – 2347 | 929 | Glu-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 42 | 1 | S → SQALFKESRYPQNMPCVCYY FSDAHFFASLSWVTSNTKEI in isoform 2. | VSP_030380 | |||||
| Natural variant | 496 | 1 | H → Y. Corresponds to variant rs12104280 [ dbSNP | Ensembl ]. | VAR_057638 | |||||
| Natural variant | 1583 | 1 | R → Q. Corresponds to variant rs6508750 [ dbSNP | Ensembl ]. | VAR_057639 | |||||
| Natural variant | 1885 | 1 | N → K. Corresponds to variant rs10422056 [ dbSNP | Ensembl ]. | VAR_057640 | |||||
| Natural variant | 2570 | 1 | H → L. Corresponds to variant rs10408510 [ dbSNP | Ensembl ]. | VAR_057641 | |||||
Experimental info | |||||||||
| Sequence conflict | 135 | 1 | T → S in AAK20167. Ref.3 | ||||||
| Sequence conflict | 177 | 1 | T → A in BAC87627. Ref.2 | ||||||
| Sequence conflict | 226 | 1 | I → T in AAK20167. Ref.3 | ||||||
| Sequence conflict | 529 | 1 | K → Q in AAK20167. Ref.3 | ||||||
| Sequence conflict | 602 | 1 | G → A in BAC87627. Ref.2 | ||||||
| Sequence conflict | 602 | 1 | G → A in AAK20167. Ref.3 | ||||||
| Sequence conflict | 817 – 818 | 2 | DR → NS in AAK20167. Ref.3 | ||||||
| Sequence conflict | 821 | 1 | E → G in AAK20167. Ref.3 | ||||||
| Sequence conflict | 939 | 1 | E → G in AAK20167. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1350 (ISOFORM 1). Tissue: Testis. |
| [3] | "Cloning of new testis gene (NYD-SP11) related to testis development from human testis cDNA library." Sha J.H. Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-1170 (ISOFORM 2). Tissue: Testis. |
| [4] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC016582 Genomic DNA. No translation available. AK128826 mRNA. Translation: BAC87627.1. AY026504 mRNA. Translation: AAK20167.2. Sequence problems. |
| IPI | IPI00397715. IPI00744524. |
| RefSeq | NP_114157.3. NM_031951.3. |
| UniGene | Hs.664194. |
3D structure databases | |
| ProteinModelPortal | Q6ZQQ6. |
| SMR | Q6ZQQ6. Positions 87-125, 213-274, 566-598. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q6ZQQ6. |
Polymorphism databases | |
| DMDM | 296453080. |
Proteomic databases | |
| PaxDb | Q6ZQQ6. |
| PRIDE | Q6ZQQ6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000303868; ENSP00000368025; ENSG00000171804. |
| GeneID | 83889. |
| KEGG | hsa:83889. |
| UCSC | uc010efu.2. human. |
Organism-specific databases | |
| CTD | 83889. |
| GeneCards | GC19M038376. |
| HGNC | HGNC:29934. WDR87. |
| HPA | HPA048269. HPA049455. |
| neXtProt | NX_Q6ZQQ6. |
| PharmGKB | PA145147633. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG129648. |
| HOGENOM | HOG000169123. |
| InParanoid | Q6ZQQ6. |
Enzyme and pathway databases | |
| SignaLink | Q6ZQQ6. |
Gene expression databases | |
| ArrayExpress | Q6ZQQ6. |
| Bgee | Q6ZQQ6. |
| CleanEx | HS_WDR87. |
| Genevestigator | Q6ZQQ6. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 4 hits. |
| InterPro | IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF00400. WD40. 2 hits. [Graphical view] |
| SMART | SM00320. WD40. 4 hits. [Graphical view] |
| SUPFAM | SSF50978. WD40_like. 1 hit. |
| PROSITE | PS00678. WD_REPEATS_1. False negative. PS50082. WD_REPEATS_2. 2 hits. PS50294. WD_REPEATS_REGION. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 83889. |
| NextBio | 72969. |
Entry information
| Entry name | WDR87_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6ZQQ6 Secondary accession number(s): Q9BWV9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
