Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6ZQQ6 (WDR87_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 87. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
WD repeat-containing protein 87
Alternative name(s):
Testis development protein NYD-SP11
Gene names
Name:WDR87
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2873 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Sequence similarities

Contains 7 WD repeats.

Sequence caution

The sequence AAK20167.2 differs from that shown. Reason: Erroneous termination at position 825. Translated as Trp.

The sequence AAK20167.2 differs from that shown. Reason: Frameshift at positions 126, 820, 1129 and 1140.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
WD repeat
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6ZQQ6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6ZQQ6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     42-42: S → SQALFKESRYPQNMPCVCYYFSDAHFFASLSWVTSNTKEI
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 28732873WD repeat-containing protein 87
PRO_0000314821

Regions

Repeat108 – 14639WD 1
Repeat199 – 23941WD 2
Repeat242 – 28342WD 3
Repeat368 – 40740WD 4
Repeat415 – 46046WD 5
Repeat516 – 55338WD 6
Repeat565 – 60440WD 7
Compositional bias1419 – 2347929Glu-rich

Natural variations

Alternative sequence421S → SQALFKESRYPQNMPCVCYY FSDAHFFASLSWVTSNTKEI in isoform 2.
VSP_030380
Natural variant4961H → Y.
Corresponds to variant rs12104280 [ dbSNP | Ensembl ].
VAR_057638
Natural variant15831R → Q.
Corresponds to variant rs6508750 [ dbSNP | Ensembl ].
VAR_057639
Natural variant18851N → K.
Corresponds to variant rs10422056 [ dbSNP | Ensembl ].
VAR_057640
Natural variant25701H → L.
Corresponds to variant rs10408510 [ dbSNP | Ensembl ].
VAR_057641

Experimental info

Sequence conflict1351T → S in AAK20167. Ref.3
Sequence conflict1771T → A in BAC87627. Ref.2
Sequence conflict2261I → T in AAK20167. Ref.3
Sequence conflict5291K → Q in AAK20167. Ref.3
Sequence conflict6021G → A in BAC87627. Ref.2
Sequence conflict6021G → A in AAK20167. Ref.3
Sequence conflict817 – 8182DR → NS in AAK20167. Ref.3
Sequence conflict8211E → G in AAK20167. Ref.3
Sequence conflict9391E → G in AAK20167. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 18, 2010. Version 3.
Checksum: E4BC3A63C503BAB4

FASTA2,873333,185
        10         20         30         40         50         60 
MSSPRLIPLW KDLKLLLNDT INKSKQPSED PKNCLIVLSD RSQAVAWMKS KTEDMVEKRT 

        70         80         90        100        110        120 
FSMTERLPPI QSMVHAGSFH ILVVYCGDLI LRLFGDHFRA FKPLGKVPCR FNISCLCYDP 

       130        140        150        160        170        180 
EMKMLLSGIL GAVVTWVIEL GGTGLQIAHM VSMPGDELVQ DIVLNGPSGS LLALCETVVR 

       190        200        210        220        230        240 
VLMHQGKGQL GEVKRFTSTS SGSSITCCFT CFDQGFLYAG NQAGEIQVWS LQQGHPLHSF 

       250        260        270        280        290        300 
QAHQSGVICI RSRPEAHTLL TAGSDSLIKE WNLTSGSLLR RLELGEELYR LQFIDSITFF 

       310        320        330        340        350        360 
CQTAHSFSLH RLPCFYSLFN VCGSAPQQLR RVCCGNNWFR ILCTTEDGLL RFVSPVTGDL 

       370        380        390        400        410        420 
LVITWPFSIL DQAVDWAYDP GKEELFVATG SSEVLVFDTT RCPCPAKYLL GTSPNSQDFV 

       430        440        450        460        470        480 
QCLAYGHFNL GRGLEGLIFS GHQSGVIRVL SQHSCARLEK FMHFGAVLAL STLSGGIFGG 

       490        500        510        520        530        540 
QGNSLLCSYG MDDYVHLSEA VLDGVKVQLR PLASILSSCH LTHLILLPKS VGAITETNCL 

       550        560        570        580        590        600 
RLWKFHDFLS SGSQNGLKFI ETLPLHLCAI TSFDVCLSLS LFVTGSADGS VRIWDFHGRL 

       610        620        630        640        650        660 
IGILDSSLHF GPVCFANDRG DLLVTFNQSL YLVSCLKLLP PALLTRLSFM SISDEVLEVP 

       670        680        690        700        710        720 
KPFIPSFFFS FETMFVPKYI YPGQAQQKLV GLEKLVNNRA IAFDHSVPHV IEEDEEGSPV 

       730        740        750        760        770        780 
LLRSSMHYSL QDMEDWMQVS KRYQCHYVLP PQLQLTSWDG LNPYQILRYY FGHGREWLFA 

       790        800        810        820        830        840 
PDCYIPNSVI RARLWPEGTP IYLQCNLHAP QRELEWDRSQ EFFFWHSRVR AISNTEYPKN 

       850        860        870        880        890        900 
KEEDEHFLEM RLSKDVTYSV LTDGANRSWL GRKMSEITIN SMIETMLNIM VHASLLKYQC 

       910        920        930        940        950        960 
CVGALGQIFA SYQVSPALRS ETARRLLNDT TNSNPLIREL AWEGLKRLGM ITHLFAMPLA 

       970        980        990       1000       1010       1020 
QGLMDKDERV RIKTLSLMAE IGIHSRTSLL QLTQKQETFR EMQQQMIGEE PLDHLLGMRA 

      1030       1040       1050       1060       1070       1080 
TDLQILSTQV EQRLNENLTL SHRDEKPAFS LDVSMPSELK SSLKPPTVSE ESEVAIKPSK 

      1090       1100       1110       1120       1130       1140 
GQRRGQAGVK KHSQKWLRGL KKTKERDSKQ MSTEPGLLED ESGTEAAPIE MEEASVYSQW 

      1150       1160       1170       1180       1190       1200 
SSSTSVIKLS KDVDSQEKDI SKDHIALTLK RLQKIRDKRD KKATAQKLKK KHKKKGKEAK 

      1210       1220       1230       1240       1250       1260 
VINEETTPPV MEQPVTKKVK IQGRGASGIS GRRSTAGDGS SWRDDLCRLM ALRISGSQTK 

      1270       1280       1290       1300       1310       1320 
MSENLNAELV TFAQEMLVDR HPSWELFQEI CPLLKKESKV LLEDLDWDVV PPEKKPIFIQ 

      1330       1340       1350       1360       1370       1380 
EGAIREDMIQ GVTQEVIRHK EVMPREEEQA QKKARDMLGL EETQVILKKG KKVIFLEPGN 

      1390       1400       1410       1420       1430       1440 
VTMGKEISKK EEKKTFQKSP KQGRKAVQKE RKVGKIKREM TKEERDMSEE VEEMATLEEK 

      1450       1460       1470       1480       1490       1500 
VVKQEGKLVM IERTPSWQDW KKAWDEWKQV HGETRKSWKA WKEEWEKRLL QEEEKLHQAG 

      1510       1520       1530       1540       1550       1560 
EKLSPEEEML QEDKKLKWEE WKQVWENMLS SKSKEQQYKD EEEVTLEEEV SREGEEKEQQ 

      1570       1580       1590       1600       1610       1620 
VTEEQRHIQE EHKWARIHRK RARAEKKRAQ EERKLAQEEE KLAQEERQLA QEERKLAQAY 

      1630       1640       1650       1660       1670       1680 
VKITQDDREM AQAEGKFAQK EETLAQRGEK LSQEAEKLAQ KRKKLAKKWE KVAREEEKLA 

      1690       1700       1710       1720       1730       1740 
KKGGKLAEVK NILAQKVEEL PQREQNLDWQ EKELAQELEE LEWDMEELSW KEEELNQEEG 

      1750       1760       1770       1780       1790       1800 
KLVEEKKKLA EEEEALAWQR EKLSEEETKL AQEEELLIQE KEKLAQHKEK MPEEEERLGR 

      1810       1820       1830       1840       1850       1860 
KREQLIEKKM KLAQKRERWI NSMEELTKNK MILYQKKNLA QEKKNLAQEK EKLAQRKENL 

      1870       1880       1890       1900       1910       1920 
LYNKERLTHS KKQLVQVKNK LGMFNKILAQ VEEKLTQEKE TVIKKKEKLA ETEKKLVQVE 

      1930       1940       1950       1960       1970       1980 
DSLAKKQEKL AQEKMKLALE KAMVQGKKRL RGELDIAKEE KALNLEMKRL AEEKMRLVEG 

      1990       2000       2010       2020       2030       2040 
KETLSKGETP ETSRQRKMTQ VEQELFERKL SLEEKILLHE DRILAMEESE IAKGKLEFTR 

      2050       2060       2070       2080       2090       2100 
GQRIFVQGQR KLAKASRKLI KKRESLSKEP AKLNKILKAL QKLTRDERKL TQEEIKMTKM 

      2110       2120       2130       2140       2150       2160 
KRALFVKERR LSIEQSKLDI KEWDFSEKRS ELTKDEKKLA RKQRKLANKM RRMINKEEKM 

      2170       2180       2190       2200       2210       2220 
TEEESKLARK HSEVILDDEE EGGIEEEEVI PFLKRRWRKR KEAKRGDKPK EKFSSQVDEV 

      2230       2240       2250       2260       2270       2280 
ESEEHFSEEM ESLLDELEKQ ESLSSEEEEE REEEEEREEE EVREEEEERK EEEEGEEKQV 

      2290       2300       2310       2320       2330       2340 
EKEEEEKKKK KKEKKKEEVQ EKEEVFEEKE EIMSEEETES LSDEEEEEES CSLEEEVDRE 

      2350       2360       2370       2380       2390       2400 
KEILKKEKQF KLQEQRRKSL RGRERVLSIL RGVPHGKGRA IRLGVLKSPL KKLMSTALEM 

      2410       2420       2430       2440       2450       2460 
KEKTPVPVPE KQISWEDKKA TVVEIPRKFL GTMDKEREVM GKYEPIPPHV LGTVLESQAQ 

      2470       2480       2490       2500       2510       2520 
DLKTPFMSHI LRRTVEAEEL QHKPLGAWWK WFLQHPPLMG QTEVQLPLSQ IPAKEQHADV 

      2530       2540       2550       2560       2570       2580 
SLSDVEWIRH VLERMEAGEQ LSRDGFHRLC QLLKDLASKG NLEWLHLAKH EAIVYRHRQA 

      2590       2600       2610       2620       2630       2640 
LESQDTRISS RQSMSPKYLK VIPPIKAKEK ESWPKPLAVP TQKSPLATKR IPDPRAKNWH 

      2650       2660       2670       2680       2690       2700 
LLGEPYRSER AQQISIAHKE MEMQYFYPAT RDIFPSAHAS VEKQTLALMF QKDFWDFKDK 

      2710       2720       2730       2740       2750       2760 
RRFPKLPKLE KKTQPISKKK EELPLWETFV ALYHVLRMLQ QRYPKDSTAW MEQFYQLMDL 

      2770       2780       2790       2800       2810       2820 
YQLKSPRIQK LLQELLMREE PQPQEIIYEE ALKATELVPG ERLFCCLFCG SSHTPRSPQE 

      2830       2840       2850       2860       2870 
FQGAVPLPWQ NCVRTILPVG IARYGILELA WKSLPEADLH LTKALTHTVA PTL 

« Hide

Isoform 2 [UniParc].

Checksum: F92E39FC2179E241
Show »

FASTA2,912337,777

References

« Hide 'large scale' references
[1]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1350 (ISOFORM 1).
Tissue: Testis.
[3]"Cloning of new testis gene (NYD-SP11) related to testis development from human testis cDNA library."
Sha J.H.
Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-1170 (ISOFORM 2).
Tissue: Testis.
[4]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC016582 Genomic DNA. No translation available.
AK128826 mRNA. Translation: BAC87627.1.
AY026504 mRNA. Translation: AAK20167.2. Sequence problems.
RefSeqNP_114157.4. NM_031951.4.
UniGeneHs.664194.

3D structure databases

ProteinModelPortalQ6ZQQ6.
SMRQ6ZQQ6. Positions 87-125, 198-275, 582-619.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123800. 1 interaction.

PTM databases

PhosphoSiteQ6ZQQ6.

Proteomic databases

PaxDbQ6ZQQ6.
PRIDEQ6ZQQ6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000303868; ENSP00000368025; ENSG00000171804. [Q6ZQQ6-1]
GeneID83889.
KEGGhsa:83889.
UCSCuc010efu.2. human. [Q6ZQQ6-1]

Organism-specific databases

CTD83889.
GeneCardsGC19M038376.
HGNCHGNC:29934. WDR87.
HPAHPA048269.
HPA049455.
neXtProtNX_Q6ZQQ6.
PharmGKBPA145147633.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG129648.
HOGENOMHOG000169123.
InParanoidQ6ZQQ6.
TreeFamTF338139.

Enzyme and pathway databases

SignaLinkQ6ZQQ6.

Gene expression databases

ArrayExpressQ6ZQQ6.
BgeeQ6ZQQ6.
CleanExHS_WDR87.
GenevestigatorQ6ZQQ6.

Family and domain databases

Gene3D2.130.10.10. 4 hits.
InterProIPR011047. Quinonprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamPF00400. WD40. 2 hits.
[Graphical view]
SMARTSM00320. WD40. 4 hits.
[Graphical view]
SUPFAMSSF50998. SSF50998. 2 hits.
PROSITEPS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi83889.
NextBio72969.
PROQ6ZQQ6.

Entry information

Entry nameWDR87_HUMAN
AccessionPrimary (citable) accession number: Q6ZQQ6
Secondary accession number(s): Q9BWV9
Entry history
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 18, 2010
Last modified: July 9, 2014
This is version 87 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM