SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6ZQQ6

- WDR87_HUMAN

UniProt

Q6ZQQ6 - WDR87_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
WD repeat-containing protein 87
Gene
WDR87
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ6ZQQ6.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 87
Alternative name(s):
Testis development protein NYD-SP11
Gene namesi
Name:WDR87
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:29934. WDR87.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145147633.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 28732873WD repeat-containing protein 87
PRO_0000314821Add
BLAST

Proteomic databases

PaxDbiQ6ZQQ6.
PRIDEiQ6ZQQ6.

PTM databases

PhosphoSiteiQ6ZQQ6.

Expressioni

Gene expression databases

ArrayExpressiQ6ZQQ6.
BgeeiQ6ZQQ6.
CleanExiHS_WDR87.
GenevestigatoriQ6ZQQ6.

Organism-specific databases

HPAiHPA048269.
HPA049455.

Interactioni

Protein-protein interaction databases

BioGridi123800. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ6ZQQ6.
SMRiQ6ZQQ6. Positions 87-125, 198-275, 582-619.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati108 – 14639WD 1
Add
BLAST
Repeati199 – 23941WD 2
Add
BLAST
Repeati242 – 28342WD 3
Add
BLAST
Repeati368 – 40740WD 4
Add
BLAST
Repeati415 – 46046WD 5
Add
BLAST
Repeati516 – 55338WD 6
Add
BLAST
Repeati565 – 60440WD 7
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1419 – 2347929Glu-rich
Add
BLAST

Sequence similaritiesi

Contains 7 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiNOG129648.
HOGENOMiHOG000169123.
InParanoidiQ6ZQQ6.
TreeFamiTF338139.

Family and domain databases

Gene3Di2.130.10.10. 4 hits.
InterProiIPR011047. Quinonprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 2 hits.
[Graphical view]
SMARTiSM00320. WD40. 4 hits.
[Graphical view]
SUPFAMiSSF50998. SSF50998. 2 hits.
PROSITEiPS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6ZQQ6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSSPRLIPLW KDLKLLLNDT INKSKQPSED PKNCLIVLSD RSQAVAWMKS     50
KTEDMVEKRT FSMTERLPPI QSMVHAGSFH ILVVYCGDLI LRLFGDHFRA 100
FKPLGKVPCR FNISCLCYDP EMKMLLSGIL GAVVTWVIEL GGTGLQIAHM 150
VSMPGDELVQ DIVLNGPSGS LLALCETVVR VLMHQGKGQL GEVKRFTSTS 200
SGSSITCCFT CFDQGFLYAG NQAGEIQVWS LQQGHPLHSF QAHQSGVICI 250
RSRPEAHTLL TAGSDSLIKE WNLTSGSLLR RLELGEELYR LQFIDSITFF 300
CQTAHSFSLH RLPCFYSLFN VCGSAPQQLR RVCCGNNWFR ILCTTEDGLL 350
RFVSPVTGDL LVITWPFSIL DQAVDWAYDP GKEELFVATG SSEVLVFDTT 400
RCPCPAKYLL GTSPNSQDFV QCLAYGHFNL GRGLEGLIFS GHQSGVIRVL 450
SQHSCARLEK FMHFGAVLAL STLSGGIFGG QGNSLLCSYG MDDYVHLSEA 500
VLDGVKVQLR PLASILSSCH LTHLILLPKS VGAITETNCL RLWKFHDFLS 550
SGSQNGLKFI ETLPLHLCAI TSFDVCLSLS LFVTGSADGS VRIWDFHGRL 600
IGILDSSLHF GPVCFANDRG DLLVTFNQSL YLVSCLKLLP PALLTRLSFM 650
SISDEVLEVP KPFIPSFFFS FETMFVPKYI YPGQAQQKLV GLEKLVNNRA 700
IAFDHSVPHV IEEDEEGSPV LLRSSMHYSL QDMEDWMQVS KRYQCHYVLP 750
PQLQLTSWDG LNPYQILRYY FGHGREWLFA PDCYIPNSVI RARLWPEGTP 800
IYLQCNLHAP QRELEWDRSQ EFFFWHSRVR AISNTEYPKN KEEDEHFLEM 850
RLSKDVTYSV LTDGANRSWL GRKMSEITIN SMIETMLNIM VHASLLKYQC 900
CVGALGQIFA SYQVSPALRS ETARRLLNDT TNSNPLIREL AWEGLKRLGM 950
ITHLFAMPLA QGLMDKDERV RIKTLSLMAE IGIHSRTSLL QLTQKQETFR 1000
EMQQQMIGEE PLDHLLGMRA TDLQILSTQV EQRLNENLTL SHRDEKPAFS 1050
LDVSMPSELK SSLKPPTVSE ESEVAIKPSK GQRRGQAGVK KHSQKWLRGL 1100
KKTKERDSKQ MSTEPGLLED ESGTEAAPIE MEEASVYSQW SSSTSVIKLS 1150
KDVDSQEKDI SKDHIALTLK RLQKIRDKRD KKATAQKLKK KHKKKGKEAK 1200
VINEETTPPV MEQPVTKKVK IQGRGASGIS GRRSTAGDGS SWRDDLCRLM 1250
ALRISGSQTK MSENLNAELV TFAQEMLVDR HPSWELFQEI CPLLKKESKV 1300
LLEDLDWDVV PPEKKPIFIQ EGAIREDMIQ GVTQEVIRHK EVMPREEEQA 1350
QKKARDMLGL EETQVILKKG KKVIFLEPGN VTMGKEISKK EEKKTFQKSP 1400
KQGRKAVQKE RKVGKIKREM TKEERDMSEE VEEMATLEEK VVKQEGKLVM 1450
IERTPSWQDW KKAWDEWKQV HGETRKSWKA WKEEWEKRLL QEEEKLHQAG 1500
EKLSPEEEML QEDKKLKWEE WKQVWENMLS SKSKEQQYKD EEEVTLEEEV 1550
SREGEEKEQQ VTEEQRHIQE EHKWARIHRK RARAEKKRAQ EERKLAQEEE 1600
KLAQEERQLA QEERKLAQAY VKITQDDREM AQAEGKFAQK EETLAQRGEK 1650
LSQEAEKLAQ KRKKLAKKWE KVAREEEKLA KKGGKLAEVK NILAQKVEEL 1700
PQREQNLDWQ EKELAQELEE LEWDMEELSW KEEELNQEEG KLVEEKKKLA 1750
EEEEALAWQR EKLSEEETKL AQEEELLIQE KEKLAQHKEK MPEEEERLGR 1800
KREQLIEKKM KLAQKRERWI NSMEELTKNK MILYQKKNLA QEKKNLAQEK 1850
EKLAQRKENL LYNKERLTHS KKQLVQVKNK LGMFNKILAQ VEEKLTQEKE 1900
TVIKKKEKLA ETEKKLVQVE DSLAKKQEKL AQEKMKLALE KAMVQGKKRL 1950
RGELDIAKEE KALNLEMKRL AEEKMRLVEG KETLSKGETP ETSRQRKMTQ 2000
VEQELFERKL SLEEKILLHE DRILAMEESE IAKGKLEFTR GQRIFVQGQR 2050
KLAKASRKLI KKRESLSKEP AKLNKILKAL QKLTRDERKL TQEEIKMTKM 2100
KRALFVKERR LSIEQSKLDI KEWDFSEKRS ELTKDEKKLA RKQRKLANKM 2150
RRMINKEEKM TEEESKLARK HSEVILDDEE EGGIEEEEVI PFLKRRWRKR 2200
KEAKRGDKPK EKFSSQVDEV ESEEHFSEEM ESLLDELEKQ ESLSSEEEEE 2250
REEEEEREEE EVREEEEERK EEEEGEEKQV EKEEEEKKKK KKEKKKEEVQ 2300
EKEEVFEEKE EIMSEEETES LSDEEEEEES CSLEEEVDRE KEILKKEKQF 2350
KLQEQRRKSL RGRERVLSIL RGVPHGKGRA IRLGVLKSPL KKLMSTALEM 2400
KEKTPVPVPE KQISWEDKKA TVVEIPRKFL GTMDKEREVM GKYEPIPPHV 2450
LGTVLESQAQ DLKTPFMSHI LRRTVEAEEL QHKPLGAWWK WFLQHPPLMG 2500
QTEVQLPLSQ IPAKEQHADV SLSDVEWIRH VLERMEAGEQ LSRDGFHRLC 2550
QLLKDLASKG NLEWLHLAKH EAIVYRHRQA LESQDTRISS RQSMSPKYLK 2600
VIPPIKAKEK ESWPKPLAVP TQKSPLATKR IPDPRAKNWH LLGEPYRSER 2650
AQQISIAHKE MEMQYFYPAT RDIFPSAHAS VEKQTLALMF QKDFWDFKDK 2700
RRFPKLPKLE KKTQPISKKK EELPLWETFV ALYHVLRMLQ QRYPKDSTAW 2750
MEQFYQLMDL YQLKSPRIQK LLQELLMREE PQPQEIIYEE ALKATELVPG 2800
ERLFCCLFCG SSHTPRSPQE FQGAVPLPWQ NCVRTILPVG IARYGILELA 2850
WKSLPEADLH LTKALTHTVA PTL 2873
Length:2,873
Mass (Da):333,185
Last modified:May 18, 2010 - v3
Checksum:iE4BC3A63C503BAB4
GO
Isoform 2 (identifier: Q6ZQQ6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-42: S → SQALFKESRYPQNMPCVCYYFSDAHFFASLSWVTSNTKEI

Note: No experimental confirmation available.

Show »
Length:2,912
Mass (Da):337,777
Checksum:iF92E39FC2179E241
GO

Sequence cautioni

The sequence AAK20167.2 differs from that shown. Reason: Frameshift at positions 126, 820, 1129 and 1140.
The sequence AAK20167.2 differs from that shown. Reason: Erroneous termination at position 825. Translated as Trp.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti496 – 4961H → Y.
Corresponds to variant rs12104280 [ dbSNP | Ensembl ].
VAR_057638
Natural varianti1583 – 15831R → Q.
Corresponds to variant rs6508750 [ dbSNP | Ensembl ].
VAR_057639
Natural varianti1885 – 18851N → K.
Corresponds to variant rs10422056 [ dbSNP | Ensembl ].
VAR_057640
Natural varianti2570 – 25701H → L.
Corresponds to variant rs10408510 [ dbSNP | Ensembl ].
VAR_057641

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei42 – 421S → SQALFKESRYPQNMPCVCYY FSDAHFFASLSWVTSNTKEI in isoform 2.
VSP_030380

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti135 – 1351T → S in AAK20167. 1 Publication
Sequence conflicti177 – 1771T → A in BAC87627. 1 Publication
Sequence conflicti226 – 2261I → T in AAK20167. 1 Publication
Sequence conflicti529 – 5291K → Q in AAK20167. 1 Publication
Sequence conflicti602 – 6021G → A in BAC87627. 1 Publication
Sequence conflicti602 – 6021G → A in AAK20167. 1 Publication
Sequence conflicti817 – 8182DR → NS in AAK20167. 1 Publication
Sequence conflicti821 – 8211E → G in AAK20167. 1 Publication
Sequence conflicti939 – 9391E → G in AAK20167. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC016582 Genomic DNA. No translation available.
AK128826 mRNA. Translation: BAC87627.1.
AY026504 mRNA. Translation: AAK20167.2. Sequence problems.
CCDSiCCDS46063.1. [Q6ZQQ6-1]
RefSeqiNP_114157.4. NM_031951.4.
UniGeneiHs.664194.

Genome annotation databases

EnsembliENST00000303868; ENSP00000368025; ENSG00000171804. [Q6ZQQ6-1]
GeneIDi83889.
UCSCiuc010efu.2. human. [Q6ZQQ6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC016582 Genomic DNA. No translation available.
AK128826 mRNA. Translation: BAC87627.1 .
AY026504 mRNA. Translation: AAK20167.2 . Sequence problems.
CCDSi CCDS46063.1. [Q6ZQQ6-1 ]
RefSeqi NP_114157.4. NM_031951.4.
UniGenei Hs.664194.

3D structure databases

ProteinModelPortali Q6ZQQ6.
SMRi Q6ZQQ6. Positions 87-125, 198-275, 582-619.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123800. 1 interaction.

PTM databases

PhosphoSitei Q6ZQQ6.

Proteomic databases

PaxDbi Q6ZQQ6.
PRIDEi Q6ZQQ6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000303868 ; ENSP00000368025 ; ENSG00000171804 . [Q6ZQQ6-1 ]
GeneIDi 83889.
UCSCi uc010efu.2. human. [Q6ZQQ6-1 ]

Organism-specific databases

GeneCardsi GC19M038376.
HGNCi HGNC:29934. WDR87.
HPAi HPA048269.
HPA049455.
neXtProti NX_Q6ZQQ6.
PharmGKBi PA145147633.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG129648.
HOGENOMi HOG000169123.
InParanoidi Q6ZQQ6.
TreeFami TF338139.

Enzyme and pathway databases

SignaLinki Q6ZQQ6.

Miscellaneous databases

GenomeRNAii 83889.
NextBioi 72969.
PROi Q6ZQQ6.

Gene expression databases

ArrayExpressi Q6ZQQ6.
Bgeei Q6ZQQ6.
CleanExi HS_WDR87.
Genevestigatori Q6ZQQ6.

Family and domain databases

Gene3Di 2.130.10.10. 4 hits.
InterProi IPR011047. Quinonprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF00400. WD40. 2 hits.
[Graphical view ]
SMARTi SM00320. WD40. 4 hits.
[Graphical view ]
SUPFAMi SSF50998. SSF50998. 2 hits.
PROSITEi PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1350 (ISOFORM 1).
    Tissue: Testis.
  3. "Cloning of new testis gene (NYD-SP11) related to testis development from human testis cDNA library."
    Sha J.H.
    Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-1170 (ISOFORM 2).
    Tissue: Testis.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiWDR87_HUMAN
AccessioniPrimary (citable) accession number: Q6ZQQ6
Secondary accession number(s): Q9BWV9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 18, 2010
Last modified: September 3, 2014
This is version 88 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi