Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6ZPK0 (PF21A_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 87. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
PHD finger protein 21A
Alternative name(s):
BHC80a
BRAF35-HDAC complex protein BHC80
Short name=mBHC80
Gene names
Name:Phf21a
Synonyms:Bhc80, Kiaa1696, Pftf1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length659 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it may act as a scaffold. Inhibits KDM1A-mediated demethylation of 'Lys-4' of histone H3 in vitro, suggesting a role in demethylation regulation By similarity.

Subunit structure

Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. In the complex, it interacts directly with HDAC1, HDAC2, HMG20B/BRAF35, KDM1A and RCOR1/CoREST By similarity.

Subcellular location

Nucleus Ref.1.

Tissue specificity

Expressed in the brain and testis. Weakly or not expressed in other tissues tested. Localized throughout the central nervous system (CNS) in brain, including the cerebellum, hippocampus, and cortex. Notably present in neuronal cells of granular cell layer and dentate gyrus in cerebellum and hippocampus, respectively. In the seminiferous tubules, the signals it is present strongly in spermatocytes, and weakly in spermatogonia and round spermatids. In some cases, it is also observed solely in spermatocytes (at protein level). Ref.1

Sequence similarities

Contains 1 A.T hook DNA-binding domain.

Contains 1 PHD-type zinc finger.

Sequence caution

The sequence BAC98234.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 9 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6ZPK0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6ZPK0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     129-212: Missing.
     341-352: LNPTQKQRKNKQ → TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQKLAFMVSL
Isoform 3 (identifier: Q6ZPK0-3)

Also known as: BHC80-6(AIF2+5);

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: Missing.
Isoform 4 (identifier: Q6ZPK0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     128-212: Missing.
     341-352: LNPTQKQRKNKQ → TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQKLAFMVSL
     409-463: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK
Isoform 5 (identifier: Q6ZPK0-5)

Also known as: BHC80-1(AIF1+3);

The sequence of this isoform differs from the canonical sequence as follows:
     128-212: Missing.
     409-463: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK
Isoform 6 (identifier: Q6ZPK0-6)

Also known as: BHC80-4(AIF2+3);

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: Missing.
     409-463: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK
Isoform 7 (identifier: Q6ZPK0-7)

Also known as: BHC80-2(AIF1+4);

The sequence of this isoform differs from the canonical sequence as follows:
     128-212: Missing.
     409-452: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQ → ANEEHWPK
Isoform 8 (identifier: Q6ZPK0-8)

Also known as: BHC80-5(AIF2+4);

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: Missing.
     409-452: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQ → ANEEHWPK
Isoform 9 (identifier: Q6ZPK0-9)

Also known as: BHC80-3(AIF1+5);

The sequence of this isoform differs from the canonical sequence as follows:
     128-212: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 659659PHD finger protein 21A
PRO_0000226768

Regions

DNA binding405 – 41713A.T hook By similarity
Zinc finger468 – 51548PHD-type
Coiled coil538 – 58245 Potential
Compositional bias4 – 116113Gln-rich

Amino acid modifications

Modified residue4241Phosphothreonine By similarity
Modified residue4271Phosphoserine By similarity

Natural variations

Alternative sequence128 – 21285Missing in isoform 4, isoform 5, isoform 7 and isoform 9.
VSP_017450
Alternative sequence129 – 21284Missing in isoform 2.
VSP_017451
Alternative sequence1291Missing in isoform 3, isoform 6 and isoform 8.
VSP_017452
Alternative sequence341 – 35212LNPTQ…RKNKQ → TVKSHPEAEEKQAESRTVTP PAAPKPKREENPQKLAFMVS L in isoform 2 and isoform 4.
VSP_017453
Alternative sequence409 – 46355GRPPK…PTSTD → ANEEHWPK in isoform 4, isoform 5 and isoform 6.
VSP_017454
Alternative sequence409 – 45244GRPPK…PAPVQ → ANEEHWPK in isoform 7 and isoform 8.
VSP_017455

Experimental info

Sequence conflict3251A → P in BAC65327. Ref.1
Sequence conflict3251A → P in BAC29735. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 7, 2006. Version 2.
Checksum: E0EECD3F02CCFF78

FASTA65972,521
        10         20         30         40         50         60 
MELQTLQEAL KVEIQVHQKL VAQMKQDPQN ADLKKQLHEL QAKITALSEK QKRVVEQLRK 

        70         80         90        100        110        120 
NLIVKQEQPD KFQIQPLSQS ENKLQTAQQQ PLQPLQQQQP QQPQQQQQQQ QQHAQQSAAA 

       130        140        150        160        170        180 
PPSLTASQKT VTTASMITTK TLPLVLKAAT ATMPASVVGQ RPTIAMVTAI NSQKAVLSTD 

       190        200        210        220        230        240 
VQNTPVNLQT SSKVTGPGAE AVQIVAKNTV TLQVQATPPQ PIKVPQFIPP PRLTPRPNFL 

       250        260        270        280        290        300 
PQVRPKPVAQ NNIPIAPAPP PMLAAPQLIQ RPVMLTKFTP TTLPTSQNSI HPVRVVNGQT 

       310        320        330        340        350        360 
ATIAKTFPMA QLTSIVIATP GTRLAGPQTV QLSKPSLEKQ LNPTQKQRKN KQGLVTHDHL 

       370        380        390        400        410        420 
EEIQSKRQER KRRTTANPVY SGAVFEPERK KSAVTYLNST MHPGTRKRGR PPKYNAVLGF 

       430        440        450        460        470        480 
GALTPTSPPS SHPDSPENEK TETTFTFPAP VQPVSLPSPT STDGDIHEDF CSVCRKSGQL 

       490        500        510        520        530        540 
LMCDTCSRVY HLDCLEPPLK TIPKGMWICP RCQDQMLKKE EAIPWPGTLA IVHSYIAYKA 

       550        560        570        580        590        600 
AKEEEKQKLL KWSSDLKQER EQLEQKVKEL SSSISKCMEM KSSILARQKE MRSSLDKVKR 

       610        620        630        640        650 
LIRLVHGVDL CRPVDSEATA GALSNGPDCT PPANAASTPA PSPSSQSCTA NCNQGEETK 

« Hide

Isoform 2 [UniParc].

Checksum: 7665C91ED1BAC6A8
Show »

FASTA60467,037
Isoform 3 (BHC80-6(AIF2+5)) [UniParc].

Checksum: F5903B7237BBBA86
Show »

FASTA65872,393
Isoform 4 [UniParc].

Checksum: 764F551F8AD5720F
Show »

FASTA55662,168
Isoform 5 (BHC80-1(AIF1+3)) [UniParc].

Checksum: CC4E08129A9721E8
Show »

FASTA52759,092
Isoform 6 (BHC80-4(AIF2+3)) [UniParc].

Checksum: A7BB50EF790E4540
Show »

FASTA61167,652
Isoform 7 (BHC80-2(AIF1+4)) [UniParc].

Checksum: 0F9B23394047C9EB
Show »

FASTA53860,174
Isoform 8 (BHC80-5(AIF2+4)) [UniParc].

Checksum: 1D5A57648E4DDA9B
Show »

FASTA62268,734
Isoform 9 (BHC80-3(AIF1+5)) [UniParc].

Checksum: C115A3BB54D6E748
Show »

FASTA57463,833

References

« Hide 'large scale' references
[1]"Characterization of BHC80 in BRAF-HDAC complex, involved in neuron-specific gene repression."
Iwase S., Januma A., Miyamoto K., Shono N., Honda A., Yanagisawa J., Baba T.
Biochem. Biophys. Res. Commun. 322:601-608(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5; 6; 7; 8 AND 9), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Tissue: Brain.
[2]"Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Embryonic tail.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6J.
Tissue: Skin.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Strain: FVB/N-3.
Tissue: Mammary tumor.
[5]"Mouse ovary and testis gene cohorts and RNA and protein developmental markers from microarray expression profiling."
Herrera L., Ottolenghi C., Forabosco A., Schlessinger D.
Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 119-303 (ISOFORM 3).
Strain: C57BL/6.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB105178 mRNA. Translation: BAC65327.1.
AK129424 Transcribed RNA. Translation: BAC98234.1. Different initiation.
AK037174 mRNA. Translation: BAC29735.1.
BC019181 mRNA. Translation: AAH19181.1.
AY206982 mRNA. Translation: AAP43962.1.
CCDSCCDS16442.1. [Q6ZPK0-4]
CCDS50645.1. [Q6ZPK0-2]
RefSeqNP_001103161.1. NM_001109691.1.
NP_620094.2. NM_138755.2.
XP_006499043.1. XM_006498980.1.
UniGeneMm.330408.

3D structure databases

ProteinModelPortalQ6ZPK0.
SMRQ6ZPK0. Positions 466-523.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid228685. 1 interaction.

PTM databases

PhosphoSiteQ6ZPK0.

Proteomic databases

PaxDbQ6ZPK0.
PRIDEQ6ZPK0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID192285.
KEGGmmu:192285.

Organism-specific databases

CTD51317.
MGIMGI:2384756. Phf21a.
RougeSearch...

Phylogenomic databases

eggNOGNOG310379.
HOGENOMHOG000231466.
HOVERGENHBG080293.

Gene expression databases

CleanExMM_PHF21A.
GenevestigatorQ6ZPK0.

Family and domain databases

Gene3D3.30.40.10. 1 hit.
InterProIPR017956. AT_hook_DNA-bd_motif.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamPF02178. AT_hook. 1 hit.
PF00628. PHD. 1 hit.
[Graphical view]
SMARTSM00384. AT_hook. 1 hit.
SM00249. PHD. 1 hit.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMSSF57903. SSF57903. 1 hit.
PROSITEPS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPHF21A. mouse.
NextBio371282.
PROQ6ZPK0.
SOURCESearch...

Entry information

Entry namePF21A_MOUSE
AccessionPrimary (citable) accession number: Q6ZPK0
Secondary accession number(s): Q6XVG0 expand/collapse secondary AC list , Q80Z33, Q8CAZ4, Q8VEC8
Entry history
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: March 7, 2006
Last modified: July 9, 2014
This is version 87 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot