Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6ZPK0

- PF21A_MOUSE

UniProt

Q6ZPK0 - PF21A_MOUSE

Protein

PHD finger protein 21A

Gene

Phf21a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 88 (01 Oct 2014)
      Sequence version 2 (07 Mar 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it may act as a scaffold. Inhibits KDM1A-mediated demethylation of 'Lys-4' of histone H3 in vitro, suggesting a role in demethylation regulation By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi405 – 41713A.T hookBy similarityAdd
    BLAST
    Zinc fingeri468 – 51548PHD-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. chromatin binding Source: MGI
    2. DNA binding Source: UniProtKB-KW
    3. zinc ion binding Source: InterPro

    GO - Biological processi

    1. chromatin modification Source: UniProtKB-KW
    2. regulation of transcription, DNA-templated Source: UniProtKB-KW
    3. suckling behavior Source: MGI
    4. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Chromatin regulator, Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    PHD finger protein 21A
    Alternative name(s):
    BHC80a
    BRAF35-HDAC complex protein BHC80
    Short name:
    mBHC80
    Gene namesi
    Name:Phf21a
    Synonyms:Bhc80, Kiaa1696, Pftf1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Unplaced

    Organism-specific databases

    MGIiMGI:2384756. Phf21a.

    Subcellular locationi

    Nucleus 1 Publication

    GO - Cellular componenti

    1. nucleus Source: MGI

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 659659PHD finger protein 21APRO_0000226768Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei424 – 4241PhosphothreonineBy similarity
    Modified residuei427 – 4271PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ6ZPK0.
    PRIDEiQ6ZPK0.

    PTM databases

    PhosphoSiteiQ6ZPK0.

    Expressioni

    Tissue specificityi

    Expressed in the brain and testis. Weakly or not expressed in other tissues tested. Localized throughout the central nervous system (CNS) in brain, including the cerebellum, hippocampus, and cortex. Notably present in neuronal cells of granular cell layer and dentate gyrus in cerebellum and hippocampus, respectively. In the seminiferous tubules, the signals it is present strongly in spermatocytes, and weakly in spermatogonia and round spermatids. In some cases, it is also observed solely in spermatocytes (at protein level).1 Publication

    Gene expression databases

    CleanExiMM_PHF21A.
    GenevestigatoriQ6ZPK0.

    Interactioni

    Subunit structurei

    Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. In the complex, it interacts directly with HDAC1, HDAC2, HMG20B/BRAF35, KDM1A and RCOR1/CoREST By similarity.By similarity

    Protein-protein interaction databases

    BioGridi228685. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6ZPK0.
    SMRiQ6ZPK0. Positions 466-523.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili538 – 58245Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi4 – 116113Gln-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 A.T hook DNA-binding domain.Curated
    Contains 1 PHD-type zinc finger.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri468 – 51548PHD-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG310379.
    HOGENOMiHOG000231466.
    HOVERGENiHBG080293.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    InterProiIPR017956. AT_hook_DNA-bd_motif.
    IPR019786. Zinc_finger_PHD-type_CS.
    IPR011011. Znf_FYVE_PHD.
    IPR001965. Znf_PHD.
    IPR019787. Znf_PHD-finger.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF02178. AT_hook. 1 hit.
    PF00628. PHD. 1 hit.
    [Graphical view]
    SMARTiSM00384. AT_hook. 1 hit.
    SM00249. PHD. 1 hit.
    SM00184. RING. 1 hit.
    [Graphical view]
    SUPFAMiSSF57903. SSF57903. 1 hit.
    PROSITEiPS01359. ZF_PHD_1. 1 hit.
    PS50016. ZF_PHD_2. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6ZPK0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MELQTLQEAL KVEIQVHQKL VAQMKQDPQN ADLKKQLHEL QAKITALSEK    50
    QKRVVEQLRK NLIVKQEQPD KFQIQPLSQS ENKLQTAQQQ PLQPLQQQQP 100
    QQPQQQQQQQ QQHAQQSAAA PPSLTASQKT VTTASMITTK TLPLVLKAAT 150
    ATMPASVVGQ RPTIAMVTAI NSQKAVLSTD VQNTPVNLQT SSKVTGPGAE 200
    AVQIVAKNTV TLQVQATPPQ PIKVPQFIPP PRLTPRPNFL PQVRPKPVAQ 250
    NNIPIAPAPP PMLAAPQLIQ RPVMLTKFTP TTLPTSQNSI HPVRVVNGQT 300
    ATIAKTFPMA QLTSIVIATP GTRLAGPQTV QLSKPSLEKQ LNPTQKQRKN 350
    KQGLVTHDHL EEIQSKRQER KRRTTANPVY SGAVFEPERK KSAVTYLNST 400
    MHPGTRKRGR PPKYNAVLGF GALTPTSPPS SHPDSPENEK TETTFTFPAP 450
    VQPVSLPSPT STDGDIHEDF CSVCRKSGQL LMCDTCSRVY HLDCLEPPLK 500
    TIPKGMWICP RCQDQMLKKE EAIPWPGTLA IVHSYIAYKA AKEEEKQKLL 550
    KWSSDLKQER EQLEQKVKEL SSSISKCMEM KSSILARQKE MRSSLDKVKR 600
    LIRLVHGVDL CRPVDSEATA GALSNGPDCT PPANAASTPA PSPSSQSCTA 650
    NCNQGEETK 659
    Length:659
    Mass (Da):72,521
    Last modified:March 7, 2006 - v2
    Checksum:iE0EECD3F02CCFF78
    GO
    Isoform 2 (identifier: Q6ZPK0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         129-212: Missing.
         341-352: LNPTQKQRKNKQ → TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQKLAFMVSL

    Show »
    Length:604
    Mass (Da):67,037
    Checksum:i7665C91ED1BAC6A8
    GO
    Isoform 3 (identifier: Q6ZPK0-3) [UniParc]FASTAAdd to Basket

    Also known as: BHC80-6(AIF2+5)

    The sequence of this isoform differs from the canonical sequence as follows:
         129-129: Missing.

    Show »
    Length:658
    Mass (Da):72,393
    Checksum:iF5903B7237BBBA86
    GO
    Isoform 4 (identifier: Q6ZPK0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         128-212: Missing.
         341-352: LNPTQKQRKNKQ → TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQKLAFMVSL
         409-463: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

    Show »
    Length:556
    Mass (Da):62,168
    Checksum:i764F551F8AD5720F
    GO
    Isoform 5 (identifier: Q6ZPK0-5) [UniParc]FASTAAdd to Basket

    Also known as: BHC80-1(AIF1+3)

    The sequence of this isoform differs from the canonical sequence as follows:
         128-212: Missing.
         409-463: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

    Show »
    Length:527
    Mass (Da):59,092
    Checksum:iCC4E08129A9721E8
    GO
    Isoform 6 (identifier: Q6ZPK0-6) [UniParc]FASTAAdd to Basket

    Also known as: BHC80-4(AIF2+3)

    The sequence of this isoform differs from the canonical sequence as follows:
         129-129: Missing.
         409-463: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

    Show »
    Length:611
    Mass (Da):67,652
    Checksum:iA7BB50EF790E4540
    GO
    Isoform 7 (identifier: Q6ZPK0-7) [UniParc]FASTAAdd to Basket

    Also known as: BHC80-2(AIF1+4)

    The sequence of this isoform differs from the canonical sequence as follows:
         128-212: Missing.
         409-452: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQ → ANEEHWPK

    Show »
    Length:538
    Mass (Da):60,174
    Checksum:i0F9B23394047C9EB
    GO
    Isoform 8 (identifier: Q6ZPK0-8) [UniParc]FASTAAdd to Basket

    Also known as: BHC80-5(AIF2+4)

    The sequence of this isoform differs from the canonical sequence as follows:
         129-129: Missing.
         409-452: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQ → ANEEHWPK

    Show »
    Length:622
    Mass (Da):68,734
    Checksum:i1D5A57648E4DDA9B
    GO
    Isoform 9 (identifier: Q6ZPK0-9) [UniParc]FASTAAdd to Basket

    Also known as: BHC80-3(AIF1+5)

    The sequence of this isoform differs from the canonical sequence as follows:
         128-212: Missing.

    Show »
    Length:574
    Mass (Da):63,833
    Checksum:iC115A3BB54D6E748
    GO

    Sequence cautioni

    The sequence BAC98234.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti325 – 3251A → P in BAC65327. (PubMed:15325272)Curated
    Sequence conflicti325 – 3251A → P in BAC29735. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei128 – 21285Missing in isoform 4, isoform 5, isoform 7 and isoform 9. 2 PublicationsVSP_017450Add
    BLAST
    Alternative sequencei129 – 21284Missing in isoform 2. 1 PublicationVSP_017451Add
    BLAST
    Alternative sequencei129 – 1291Missing in isoform 3, isoform 6 and isoform 8. 2 PublicationsVSP_017452
    Alternative sequencei341 – 35212LNPTQ…RKNKQ → TVKSHPEAEEKQAESRTVTP PAAPKPKREENPQKLAFMVS L in isoform 2 and isoform 4. 3 PublicationsVSP_017453Add
    BLAST
    Alternative sequencei409 – 46355GRPPK…PTSTD → ANEEHWPK in isoform 4, isoform 5 and isoform 6. 2 PublicationsVSP_017454Add
    BLAST
    Alternative sequencei409 – 45244GRPPK…PAPVQ → ANEEHWPK in isoform 7 and isoform 8. 1 PublicationVSP_017455Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB105178 mRNA. Translation: BAC65327.1.
    AK129424 Transcribed RNA. Translation: BAC98234.1. Different initiation.
    AK037174 mRNA. Translation: BAC29735.1.
    BC019181 mRNA. Translation: AAH19181.1.
    AY206982 mRNA. Translation: AAP43962.1.
    CCDSiCCDS16442.1. [Q6ZPK0-4]
    CCDS50645.1. [Q6ZPK0-2]
    RefSeqiNP_001103161.1. NM_001109691.1.
    NP_620094.2. NM_138755.2.
    XP_006499043.1. XM_006498980.1.
    UniGeneiMm.330408.

    Genome annotation databases

    GeneIDi192285.
    KEGGimmu:192285.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB105178 mRNA. Translation: BAC65327.1 .
    AK129424 Transcribed RNA. Translation: BAC98234.1 . Different initiation.
    AK037174 mRNA. Translation: BAC29735.1 .
    BC019181 mRNA. Translation: AAH19181.1 .
    AY206982 mRNA. Translation: AAP43962.1 .
    CCDSi CCDS16442.1. [Q6ZPK0-4 ]
    CCDS50645.1. [Q6ZPK0-2 ]
    RefSeqi NP_001103161.1. NM_001109691.1.
    NP_620094.2. NM_138755.2.
    XP_006499043.1. XM_006498980.1.
    UniGenei Mm.330408.

    3D structure databases

    ProteinModelPortali Q6ZPK0.
    SMRi Q6ZPK0. Positions 466-523.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 228685. 1 interaction.

    PTM databases

    PhosphoSitei Q6ZPK0.

    Proteomic databases

    PaxDbi Q6ZPK0.
    PRIDEi Q6ZPK0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 192285.
    KEGGi mmu:192285.

    Organism-specific databases

    CTDi 51317.
    MGIi MGI:2384756. Phf21a.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG310379.
    HOGENOMi HOG000231466.
    HOVERGENi HBG080293.

    Miscellaneous databases

    ChiTaRSi PHF21A. mouse.
    NextBioi 371282.
    PROi Q6ZPK0.
    SOURCEi Search...

    Gene expression databases

    CleanExi MM_PHF21A.
    Genevestigatori Q6ZPK0.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    InterProi IPR017956. AT_hook_DNA-bd_motif.
    IPR019786. Zinc_finger_PHD-type_CS.
    IPR011011. Znf_FYVE_PHD.
    IPR001965. Znf_PHD.
    IPR019787. Znf_PHD-finger.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF02178. AT_hook. 1 hit.
    PF00628. PHD. 1 hit.
    [Graphical view ]
    SMARTi SM00384. AT_hook. 1 hit.
    SM00249. PHD. 1 hit.
    SM00184. RING. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57903. SSF57903. 1 hit.
    PROSITEi PS01359. ZF_PHD_1. 1 hit.
    PS50016. ZF_PHD_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of BHC80 in BRAF-HDAC complex, involved in neuron-specific gene repression."
      Iwase S., Januma A., Miyamoto K., Shono N., Honda A., Yanagisawa J., Baba T.
      Biochem. Biophys. Res. Commun. 322:601-608(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5; 6; 7; 8 AND 9), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Brain.
    2. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
      DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Embryonic tail.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Skin.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Strain: FVB/N-3.
      Tissue: Mammary tumor.
    5. "Mouse ovary and testis gene cohorts and RNA and protein developmental markers from microarray expression profiling."
      Herrera L., Ottolenghi C., Forabosco A., Schlessinger D.
      Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 119-303 (ISOFORM 3).
      Strain: C57BL/6.

    Entry informationi

    Entry nameiPF21A_MOUSE
    AccessioniPrimary (citable) accession number: Q6ZPK0
    Secondary accession number(s): Q6XVG0
    , Q80Z33, Q8CAZ4, Q8VEC8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 7, 2006
    Last sequence update: March 7, 2006
    Last modified: October 1, 2014
    This is version 88 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3