Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 91

Gene

TMEM91

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:G66-33925-MONOMER.

Protein family/group databases

TCDBi8.A.58.2.3. the dispanin (dispanin) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 91
Alternative name(s):
Dispanin subfamily C member 3
Short name:
DSPC3
Gene namesi
Name:TMEM91
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:32393. TMEM91.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 97ExtracellularSequence analysisAdd BLAST97
Transmembranei98 – 118HelicalSequence analysisAdd BLAST21
Topological domaini119 – 139CytoplasmicSequence analysisAdd BLAST21
Transmembranei140 – 160HelicalSequence analysisAdd BLAST21
Topological domaini161 – 172ExtracellularSequence analysisAdd BLAST12

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000142046.
PharmGKBiPA142670743.

Polymorphism and mutation databases

BioMutaiTMEM91.
DMDMi55976711.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001356991 – 172Transmembrane protein 91Add BLAST172

Proteomic databases

PaxDbiQ6ZNR0.
PRIDEiQ6ZNR0.

PTM databases

iPTMnetiQ6ZNR0.
PhosphoSitePlusiQ6ZNR0.

Expressioni

Gene expression databases

BgeeiENSG00000142046.
CleanExiHS_TMEM91.
ExpressionAtlasiQ6ZNR0. baseline and differential.
GenevisibleiQ6ZNR0. HS.

Organism-specific databases

HPAiHPA053240.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000375859.

Structurei

3D structure databases

ProteinModelPortaliQ6ZNR0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CD225/Dispanin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IWEQ. Eukaryota.
ENOG410XVDW. LUCA.
GeneTreeiENSGT00390000009914.
HOGENOMiHOG000143399.
HOVERGENiHBG062452.
InParanoidiQ6ZNR0.
PhylomeDBiQ6ZNR0.
TreeFamiTF331357.

Family and domain databases

InterProiIPR007593. CD225/Dispanin_fam.
[Graphical view]
PfamiPF04505. CD225. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZNR0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSPSLRELQ QPLLEGTECE TPAQKPGRHE LGSPLREIAF AESLRGLQFL
60 70 80 90 100
SPPLPSVSAG LGEPRPPDVE DMSSSDSDSD WDGGSRLSPF LPHDHLGLAV
110 120 130 140 150
FSMLCCFWPV GIAAFCLAQK TNKAWAKGDI QGAGAASRRA FLLGVLAVGL
160 170
GVCTYAAALV TLAAYLASRD PP
Length:172
Mass (Da):18,162
Last modified:July 5, 2004 - v1
Checksum:i5F8CAAC51D662BD3
GO
Isoform 2 (identifier: Q6ZNR0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-172: TNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPP → HPQCLTYSRCYVSAFGIHA

Note: No experimental confirmation available.
Show »
Length:139
Mass (Da):15,097
Checksum:i301F38376CF4916D
GO
Isoform 3 (identifier: Q6ZNR0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-172: TNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPP → LPLQPSL

Note: No experimental confirmation available.
Show »
Length:127
Mass (Da):13,711
Checksum:iF267E453D10D4C80
GO
Isoform 4 (identifier: Q6ZNR0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-172: TNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPP → PSL

Note: No experimental confirmation available.
Show »
Length:123
Mass (Da):13,259
Checksum:i810F8CC0F94AD91A
GO
Isoform 5 (identifier: Q6ZNR0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-171: NKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDP → RPSCPYSPHCE

Note: No experimental confirmation available.
Show »
Length:133
Mass (Da):14,417
Checksum:i4B43F165F4953E15
GO

Sequence cautioni

The sequence BM931402 differs from that shown. Reason: Frameshift at position 122.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1M → L in BX090160 (Ref. 2) Curated1
Sequence conflicti114A → G in BM931402 (PubMed:8889548).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042819121 – 172TNKAW…SRDPP → HPQCLTYSRCYVSAFGIHA in isoform 2. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_045717121 – 172TNKAW…SRDPP → LPLQPSL in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_047211121 – 172TNKAW…SRDPP → PSL in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_047212122 – 171NKAWA…ASRDP → RPSCPYSPHCE in isoform 5. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BM931402 mRNA. No translation available.
BX090160 mRNA. No translation available.
AK130820 mRNA. Translation: BAC85439.1.
AC011462 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW57037.1.
BC063705 mRNA. Translation: AAH63705.1.
BF684543 mRNA. No translation available.
CCDSiCCDS42571.1. [Q6ZNR0-1]
CCDS42572.1. [Q6ZNR0-2]
CCDS46082.1. [Q6ZNR0-5]
CCDS46083.1. [Q6ZNR0-3]
CCDS46084.1. [Q6ZNR0-4]
RefSeqiNP_001036060.1. NM_001042595.2. [Q6ZNR0-2]
NP_001092291.1. NM_001098821.1. [Q6ZNR0-1]
NP_001092292.1. NM_001098822.1. [Q6ZNR0-5]
NP_001092293.1. NM_001098823.1. [Q6ZNR0-3]
NP_001092294.1. NM_001098824.1. [Q6ZNR0-4]
NP_001092295.1. NM_001098825.1. [Q6ZNR0-5]
UniGeneiHs.709417.

Genome annotation databases

EnsembliENST00000356385; ENSP00000348750; ENSG00000142046. [Q6ZNR0-2]
ENST00000392002; ENSP00000375859; ENSG00000142046. [Q6ZNR0-1]
ENST00000413014; ENSP00000413192; ENSG00000142046. [Q6ZNR0-5]
ENST00000436170; ENSP00000407003; ENSG00000142046. [Q6ZNR0-4]
ENST00000447302; ENSP00000405647; ENSG00000142046. [Q6ZNR0-3]
ENST00000544232; ENSP00000437779; ENSG00000142046. [Q6ZNR0-5]
GeneIDi641649.
KEGGihsa:641649.
UCSCiuc002oqk.5. human. [Q6ZNR0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BM931402 mRNA. No translation available.
BX090160 mRNA. No translation available.
AK130820 mRNA. Translation: BAC85439.1.
AC011462 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW57037.1.
BC063705 mRNA. Translation: AAH63705.1.
BF684543 mRNA. No translation available.
CCDSiCCDS42571.1. [Q6ZNR0-1]
CCDS42572.1. [Q6ZNR0-2]
CCDS46082.1. [Q6ZNR0-5]
CCDS46083.1. [Q6ZNR0-3]
CCDS46084.1. [Q6ZNR0-4]
RefSeqiNP_001036060.1. NM_001042595.2. [Q6ZNR0-2]
NP_001092291.1. NM_001098821.1. [Q6ZNR0-1]
NP_001092292.1. NM_001098822.1. [Q6ZNR0-5]
NP_001092293.1. NM_001098823.1. [Q6ZNR0-3]
NP_001092294.1. NM_001098824.1. [Q6ZNR0-4]
NP_001092295.1. NM_001098825.1. [Q6ZNR0-5]
UniGeneiHs.709417.

3D structure databases

ProteinModelPortaliQ6ZNR0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000375859.

Protein family/group databases

TCDBi8.A.58.2.3. the dispanin (dispanin) family.

PTM databases

iPTMnetiQ6ZNR0.
PhosphoSitePlusiQ6ZNR0.

Polymorphism and mutation databases

BioMutaiTMEM91.
DMDMi55976711.

Proteomic databases

PaxDbiQ6ZNR0.
PRIDEiQ6ZNR0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356385; ENSP00000348750; ENSG00000142046. [Q6ZNR0-2]
ENST00000392002; ENSP00000375859; ENSG00000142046. [Q6ZNR0-1]
ENST00000413014; ENSP00000413192; ENSG00000142046. [Q6ZNR0-5]
ENST00000436170; ENSP00000407003; ENSG00000142046. [Q6ZNR0-4]
ENST00000447302; ENSP00000405647; ENSG00000142046. [Q6ZNR0-3]
ENST00000544232; ENSP00000437779; ENSG00000142046. [Q6ZNR0-5]
GeneIDi641649.
KEGGihsa:641649.
UCSCiuc002oqk.5. human. [Q6ZNR0-1]

Organism-specific databases

CTDi641649.
GeneCardsiTMEM91.
HGNCiHGNC:32393. TMEM91.
HPAiHPA053240.
neXtProtiNX_Q6ZNR0.
OpenTargetsiENSG00000142046.
PharmGKBiPA142670743.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IWEQ. Eukaryota.
ENOG410XVDW. LUCA.
GeneTreeiENSGT00390000009914.
HOGENOMiHOG000143399.
HOVERGENiHBG062452.
InParanoidiQ6ZNR0.
PhylomeDBiQ6ZNR0.
TreeFamiTF331357.

Enzyme and pathway databases

BioCyciZFISH:G66-33925-MONOMER.

Miscellaneous databases

ChiTaRSiTMEM91. human.
GenomeRNAii641649.
PROiQ6ZNR0.

Gene expression databases

BgeeiENSG00000142046.
CleanExiHS_TMEM91.
ExpressionAtlasiQ6ZNR0. baseline and differential.
GenevisibleiQ6ZNR0. HS.

Family and domain databases

InterProiIPR007593. CD225/Dispanin_fam.
[Graphical view]
PfamiPF04505. CD225. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTMM91_HUMAN
AccessioniPrimary (citable) accession number: Q6ZNR0
Secondary accession number(s): C9J9D1
, C9JZ62, C9K046, Q6P434
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: July 5, 2004
Last modified: November 2, 2016
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.