Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 91

Gene

TMEM91

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

GO - Biological processi

Protein family/group databases

TCDBi8.A.58.2.3 the dispanin (dispanin) family

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 91
Alternative name(s):
Dispanin subfamily C member 3
Short name:
DSPC3
Gene namesi
Name:TMEM91
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000142046.14
HGNCiHGNC:32393 TMEM91
neXtProtiNX_Q6ZNR0

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 97ExtracellularSequence analysisAdd BLAST97
Transmembranei98 – 118HelicalSequence analysisAdd BLAST21
Topological domaini119 – 139CytoplasmicSequence analysisAdd BLAST21
Transmembranei140 – 160HelicalSequence analysisAdd BLAST21
Topological domaini161 – 172ExtracellularSequence analysisAdd BLAST12

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000142046
PharmGKBiPA142670743

Polymorphism and mutation databases

BioMutaiTMEM91
DMDMi55976711

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001356991 – 172Transmembrane protein 91Add BLAST172

Proteomic databases

PaxDbiQ6ZNR0
PRIDEiQ6ZNR0

PTM databases

iPTMnetiQ6ZNR0
PhosphoSitePlusiQ6ZNR0

Expressioni

Gene expression databases

BgeeiENSG00000142046
CleanExiHS_TMEM91
ExpressionAtlasiQ6ZNR0 baseline and differential
GenevisibleiQ6ZNR0 HS

Organism-specific databases

HPAiHPA053240

Interactioni

Protein-protein interaction databases

BioGridi535010, 1 interactor
IntActiQ6ZNR0, 1 interactor
STRINGi9606.ENSP00000375859

Structurei

3D structure databases

ProteinModelPortaliQ6ZNR0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CD225/Dispanin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IWEQ Eukaryota
ENOG410XVDW LUCA
GeneTreeiENSGT00390000009914
HOGENOMiHOG000143399
HOVERGENiHBG062452
InParanoidiQ6ZNR0
PhylomeDBiQ6ZNR0
TreeFamiTF331357

Family and domain databases

InterProiView protein in InterPro
IPR007593 CD225/Dispanin_fam
PfamiView protein in Pfam
PF04505 CD225, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZNR0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSPSLRELQ QPLLEGTECE TPAQKPGRHE LGSPLREIAF AESLRGLQFL
60 70 80 90 100
SPPLPSVSAG LGEPRPPDVE DMSSSDSDSD WDGGSRLSPF LPHDHLGLAV
110 120 130 140 150
FSMLCCFWPV GIAAFCLAQK TNKAWAKGDI QGAGAASRRA FLLGVLAVGL
160 170
GVCTYAAALV TLAAYLASRD PP
Length:172
Mass (Da):18,162
Last modified:July 5, 2004 - v1
Checksum:i5F8CAAC51D662BD3
GO
Isoform 2 (identifier: Q6ZNR0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-172: TNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPP → HPQCLTYSRCYVSAFGIHA

Note: No experimental confirmation available.
Show »
Length:139
Mass (Da):15,097
Checksum:i301F38376CF4916D
GO
Isoform 3 (identifier: Q6ZNR0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-172: TNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPP → LPLQPSL

Note: No experimental confirmation available.
Show »
Length:127
Mass (Da):13,711
Checksum:iF267E453D10D4C80
GO
Isoform 4 (identifier: Q6ZNR0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-172: TNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPP → PSL

Note: No experimental confirmation available.
Show »
Length:123
Mass (Da):13,259
Checksum:i810F8CC0F94AD91A
GO
Isoform 5 (identifier: Q6ZNR0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-171: NKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDP → RPSCPYSPHCE

Note: No experimental confirmation available.
Show »
Length:133
Mass (Da):14,417
Checksum:i4B43F165F4953E15
GO

Sequence cautioni

The sequence BM931402 differs from that shown. Reason: Frameshift at position 122.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1M → L in BX090160 (Ref. 2) Curated1
Sequence conflicti114A → G in BM931402 (PubMed:8889548).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042819121 – 172TNKAW…SRDPP → HPQCLTYSRCYVSAFGIHA in isoform 2. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_045717121 – 172TNKAW…SRDPP → LPLQPSL in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_047211121 – 172TNKAW…SRDPP → PSL in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_047212122 – 171NKAWA…ASRDP → RPSCPYSPHCE in isoform 5. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BM931402 mRNA No translation available.
BX090160 mRNA No translation available.
AK130820 mRNA Translation: BAC85439.1
AC011462 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW57037.1
BC063705 mRNA Translation: AAH63705.1
BF684543 mRNA No translation available.
CCDSiCCDS42571.1 [Q6ZNR0-1]
CCDS42572.1 [Q6ZNR0-2]
CCDS46082.1 [Q6ZNR0-5]
CCDS46083.1 [Q6ZNR0-3]
CCDS46084.1 [Q6ZNR0-4]
RefSeqiNP_001036060.1, NM_001042595.2 [Q6ZNR0-2]
NP_001092291.1, NM_001098821.1 [Q6ZNR0-1]
NP_001092292.1, NM_001098822.1 [Q6ZNR0-5]
NP_001092293.1, NM_001098823.1 [Q6ZNR0-3]
NP_001092294.1, NM_001098824.1 [Q6ZNR0-4]
NP_001092295.1, NM_001098825.1 [Q6ZNR0-5]
UniGeneiHs.709417

Genome annotation databases

EnsembliENST00000356385; ENSP00000348750; ENSG00000142046 [Q6ZNR0-2]
ENST00000392002; ENSP00000375859; ENSG00000142046 [Q6ZNR0-1]
ENST00000413014; ENSP00000413192; ENSG00000142046 [Q6ZNR0-5]
ENST00000436170; ENSP00000407003; ENSG00000142046 [Q6ZNR0-4]
ENST00000447302; ENSP00000405647; ENSG00000142046 [Q6ZNR0-3]
ENST00000544232; ENSP00000437779; ENSG00000142046 [Q6ZNR0-5]
GeneIDi641649
KEGGihsa:641649
UCSCiuc002oqk.5 human [Q6ZNR0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiTMM91_HUMAN
AccessioniPrimary (citable) accession number: Q6ZNR0
Secondary accession number(s): C9J9D1
, C9JZ62, C9K046, Q6P434
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: July 5, 2004
Last modified: March 28, 2018
This is version 101 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health