Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 793

Gene

ZNF793

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri227 – 24923C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri255 – 27723C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri283 – 30523C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri311 – 33323C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri339 – 36123C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri367 – 38923C2H2-type 6PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 793
Gene namesi
Name:ZNF793
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:33115. ZNF793.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162410548.

Polymorphism and mutation databases

BioMutaiZNF793.
DMDMi527504072.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 406406Zinc finger protein 793PRO_0000293699Add
BLAST

Proteomic databases

PaxDbiQ6ZN11.
PeptideAtlasiQ6ZN11.
PRIDEiQ6ZN11.

PTM databases

iPTMnetiQ6ZN11.
PhosphoSiteiQ6ZN11.

Expressioni

Gene expression databases

BgeeiENSG00000188227.
CleanExiHS_ZNF793.
ExpressionAtlasiQ6ZN11. baseline and differential.
GenevisibleiQ6ZN11. HS.

Organism-specific databases

HPAiHPA034781.

Interactioni

Protein-protein interaction databases

IntActiQ6ZN11. 1 interaction.
STRINGi9606.ENSP00000396402.

Structurei

3D structure databases

ProteinModelPortaliQ6ZN11.
SMRiQ6ZN11. Positions 8-49, 104-394.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini8 – 7972KRABPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 6 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri227 – 24923C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri255 – 27723C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri283 – 30523C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri311 – 33323C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri339 – 36123C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri367 – 38923C2H2-type 6PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129857.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ6ZN11.
KOiK09228.
OMAiPALMYKP.
OrthoDBiEOG091G02KC.
PhylomeDBiQ6ZN11.
TreeFamiTF340838.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 6 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 6 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZN11-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIEYQIPVSF KDVVVGFTQE EWHRLSPAQR ALYRDVMLET YSNLVSVGYE
60 70 80 90 100
GTKPDVILRL EQEEAPWIGE AACPGCHCWE DIWRVNIQRK RRQDMLLRPG
110 120 130 140 150
AAISKKTLPK EKSCEYNKFG KISLLSTDLF SSIQSPSNWN PCGKNLNHNL
160 170 180 190 200
DLIGFKRNCA KKQDECYAYG KLLQRINHGR RPNGEKPRGC SHCEKAFTQN
210 220 230 240 250
PALMYKPAVS DSLLYKRKRV PPTEKPHVCS ECGKAFCYKS EFIRHQRSHT
260 270 280 290 300
GEKPYGCTDC GKAFSHKSTL IKHQRIHTGV RPFECFFCGK AFTQKSHRTE
310 320 330 340 350
HQRTHTGERP FVCSECGKSF GEKSYLNVHR KMHTGERPYR CRECGKSFSQ
360 370 380 390 400
KSCLNKHWRT HTGEKPYGCN ECGKAFYQKP NLSRHQKIHA RKNAYRNENL

IIVGNT
Length:406
Mass (Da):46,927
Last modified:July 24, 2013 - v2
Checksum:i3A037ABF2ACBF1C2
GO
Isoform 2 (identifier: Q6ZN11-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     362-406: TGEKPYGCNECGKAFYQKPNLSRHQKIHARKNAYRNENLIIVGNT → FGESSLRSKSSNT

Note: No experimental confirmation available.
Show »
Length:374
Mass (Da):43,163
Checksum:iA13F9928372E8BAC
GO
Isoform 3 (identifier: Q6ZN11-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-94: Missing.

Show »
Length:312
Mass (Da):35,863
Checksum:i7CB985EF4E6D0521
GO

Sequence cautioni

The sequence CAD97772 differs from that shown. Reason: Frameshift at position 291. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti45 – 451V → A in BAD18564 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti68 – 681I → M.
Corresponds to variant rs12977460 [ dbSNP | Ensembl ].
VAR_033107
Natural varianti133 – 1331I → V.
Corresponds to variant rs45593644 [ dbSNP | Ensembl ].
VAR_061967

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9494Missing in isoform 3. 1 PublicationVSP_026564Add
BLAST
Alternative sequencei362 – 40645TGEKP…IVGNT → FGESSLRSKSSNT in isoform 2. 1 PublicationVSP_026565Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131417 mRNA. Translation: BAD18564.1.
AC022148 Genomic DNA. No translation available.
BX537524 mRNA. Translation: CAD97772.1. Frameshift.
CCDSiCCDS46062.1. [Q6ZN11-1]
RefSeqiNP_001013681.2. NM_001013659.2. [Q6ZN11-1]
XP_005258984.1. XM_005258927.3. [Q6ZN11-1]
XP_006723276.1. XM_006723213.3. [Q6ZN11-1]
UniGeneiHs.568010.

Genome annotation databases

EnsembliENST00000445217; ENSP00000396402; ENSG00000188227. [Q6ZN11-1]
ENST00000587143; ENSP00000468605; ENSG00000188227. [Q6ZN11-1]
GeneIDi390927.
KEGGihsa:390927.
UCSCiuc010xts.3. human. [Q6ZN11-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131417 mRNA. Translation: BAD18564.1.
AC022148 Genomic DNA. No translation available.
BX537524 mRNA. Translation: CAD97772.1. Frameshift.
CCDSiCCDS46062.1. [Q6ZN11-1]
RefSeqiNP_001013681.2. NM_001013659.2. [Q6ZN11-1]
XP_005258984.1. XM_005258927.3. [Q6ZN11-1]
XP_006723276.1. XM_006723213.3. [Q6ZN11-1]
UniGeneiHs.568010.

3D structure databases

ProteinModelPortaliQ6ZN11.
SMRiQ6ZN11. Positions 8-49, 104-394.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ6ZN11. 1 interaction.
STRINGi9606.ENSP00000396402.

PTM databases

iPTMnetiQ6ZN11.
PhosphoSiteiQ6ZN11.

Polymorphism and mutation databases

BioMutaiZNF793.
DMDMi527504072.

Proteomic databases

PaxDbiQ6ZN11.
PeptideAtlasiQ6ZN11.
PRIDEiQ6ZN11.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000445217; ENSP00000396402; ENSG00000188227. [Q6ZN11-1]
ENST00000587143; ENSP00000468605; ENSG00000188227. [Q6ZN11-1]
GeneIDi390927.
KEGGihsa:390927.
UCSCiuc010xts.3. human. [Q6ZN11-1]

Organism-specific databases

CTDi390927.
GeneCardsiZNF793.
HGNCiHGNC:33115. ZNF793.
HPAiHPA034781.
neXtProtiNX_Q6ZN11.
PharmGKBiPA162410548.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129857.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ6ZN11.
KOiK09228.
OMAiPALMYKP.
OrthoDBiEOG091G02KC.
PhylomeDBiQ6ZN11.
TreeFamiTF340838.

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

ChiTaRSiZNF793. human.
GenomeRNAii390927.
PROiQ6ZN11.

Gene expression databases

BgeeiENSG00000188227.
CleanExiHS_ZNF793.
ExpressionAtlasiQ6ZN11. baseline and differential.
GenevisibleiQ6ZN11. HS.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 6 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 6 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN793_HUMAN
AccessioniPrimary (citable) accession number: Q6ZN11
Secondary accession number(s): E9PGN4, Q7Z3Q9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 24, 2013
Last modified: September 7, 2016
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.