Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 793

Gene

ZNF793

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri227 – 249C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri255 – 277C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri283 – 305C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri311 – 333C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri339 – 361C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri367 – 389C2H2-type 6PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 793
Gene namesi
Name:ZNF793
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000188227.12.
HGNCiHGNC:33115. ZNF793.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi390927.
OpenTargetsiENSG00000188227.
PharmGKBiPA162410548.

Polymorphism and mutation databases

BioMutaiZNF793.
DMDMi527504072.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002936991 – 406Zinc finger protein 793Add BLAST406

Proteomic databases

MaxQBiQ6ZN11.
PaxDbiQ6ZN11.
PeptideAtlasiQ6ZN11.
PRIDEiQ6ZN11.

PTM databases

iPTMnetiQ6ZN11.
PhosphoSitePlusiQ6ZN11.

Expressioni

Gene expression databases

BgeeiENSG00000188227.
CleanExiHS_ZNF793.
ExpressionAtlasiQ6ZN11. baseline and differential.
GenevisibleiQ6ZN11. HS.

Organism-specific databases

HPAiHPA034781.

Interactioni

Protein-protein interaction databases

IntActiQ6ZN11. 1 interactor.
STRINGi9606.ENSP00000396402.

Structurei

3D structure databases

ProteinModelPortaliQ6ZN11.
SMRiQ6ZN11.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini8 – 79KRABPROSITE-ProRule annotationAdd BLAST72

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri227 – 249C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri255 – 277C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri283 – 305C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri311 – 333C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri339 – 361C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri367 – 389C2H2-type 6PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00900000141000.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ6ZN11.
KOiK09228.
OMAiPALMYKP.
OrthoDBiEOG091G02KC.
PhylomeDBiQ6ZN11.
TreeFamiTF340838.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
InterProiView protein in InterPro
IPR001909. KRAB.
IPR036051. KRAB_dom_sf.
IPR036236. Znf_C2H2_sf.
IPR013087. Znf_C2H2_type.
PfamiView protein in Pfam
PF01352. KRAB. 1 hit.
SMARTiView protein in SMART
SM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 6 hits.
SUPFAMiSSF109640. SSF109640. 1 hit.
SSF57667. SSF57667. 3 hits.
PROSITEiView protein in PROSITE
PS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZN11-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIEYQIPVSF KDVVVGFTQE EWHRLSPAQR ALYRDVMLET YSNLVSVGYE
60 70 80 90 100
GTKPDVILRL EQEEAPWIGE AACPGCHCWE DIWRVNIQRK RRQDMLLRPG
110 120 130 140 150
AAISKKTLPK EKSCEYNKFG KISLLSTDLF SSIQSPSNWN PCGKNLNHNL
160 170 180 190 200
DLIGFKRNCA KKQDECYAYG KLLQRINHGR RPNGEKPRGC SHCEKAFTQN
210 220 230 240 250
PALMYKPAVS DSLLYKRKRV PPTEKPHVCS ECGKAFCYKS EFIRHQRSHT
260 270 280 290 300
GEKPYGCTDC GKAFSHKSTL IKHQRIHTGV RPFECFFCGK AFTQKSHRTE
310 320 330 340 350
HQRTHTGERP FVCSECGKSF GEKSYLNVHR KMHTGERPYR CRECGKSFSQ
360 370 380 390 400
KSCLNKHWRT HTGEKPYGCN ECGKAFYQKP NLSRHQKIHA RKNAYRNENL

IIVGNT
Length:406
Mass (Da):46,927
Last modified:July 24, 2013 - v2
Checksum:i3A037ABF2ACBF1C2
GO
Isoform 2 (identifier: Q6ZN11-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     362-406: TGEKPYGCNECGKAFYQKPNLSRHQKIHARKNAYRNENLIIVGNT → FGESSLRSKSSNT

Note: No experimental confirmation available.
Show »
Length:374
Mass (Da):43,163
Checksum:iA13F9928372E8BAC
GO
Isoform 3 (identifier: Q6ZN11-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-94: Missing.

Show »
Length:312
Mass (Da):35,863
Checksum:i7CB985EF4E6D0521
GO

Sequence cautioni

The sequence CAD97772 differs from that shown. Reason: Frameshift at position 291.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti45V → A in BAD18564 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03310768I → M. Corresponds to variant dbSNP:rs12977460Ensembl.1
Natural variantiVAR_061967133I → V. Corresponds to variant dbSNP:rs45593644Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0265641 – 94Missing in isoform 3. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_026565362 – 406TGEKP…IVGNT → FGESSLRSKSSNT in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131417 mRNA. Translation: BAD18564.1.
AC022148 Genomic DNA. No translation available.
BX537524 mRNA. Translation: CAD97772.1. Frameshift.
CCDSiCCDS46062.1. [Q6ZN11-1]
RefSeqiNP_001013681.2. NM_001013659.2. [Q6ZN11-1]
XP_005258984.1. XM_005258927.3. [Q6ZN11-1]
XP_006723276.1. XM_006723213.3. [Q6ZN11-1]
UniGeneiHs.568010.

Genome annotation databases

EnsembliENST00000445217; ENSP00000396402; ENSG00000188227. [Q6ZN11-1]
ENST00000587143; ENSP00000468605; ENSG00000188227. [Q6ZN11-1]
GeneIDi390927.
KEGGihsa:390927.
UCSCiuc010xts.3. human. [Q6ZN11-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiZN793_HUMAN
AccessioniPrimary (citable) accession number: Q6ZN11
Secondary accession number(s): E9PGN4, Q7Z3Q9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 24, 2013
Last modified: October 25, 2017
This is version 122 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families