Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat-containing protein 88

Gene

WDR88

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ6ZMY6.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 88
Alternative name(s):
PQQ repeat and WD repeat-containing protein
Gene namesi
Name:WDR88
Synonyms:PQWD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:26999. WDR88.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162409139.

Polymorphism and mutation databases

BioMutaiWDR88.
DMDMi296453028.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 472472WD repeat-containing protein 88PRO_0000285630Add
BLAST

Proteomic databases

PaxDbiQ6ZMY6.
PRIDEiQ6ZMY6.

PTM databases

iPTMnetiQ6ZMY6.
PhosphoSiteiQ6ZMY6.

Expressioni

Gene expression databases

BgeeiQ6ZMY6.
CleanExiHS_WDR88.
ExpressionAtlasiQ6ZMY6. baseline and differential.
GenevisibleiQ6ZMY6. HS.

Organism-specific databases

HPAiHPA041916.

Interactioni

Protein-protein interaction databases

BioGridi125970. 1 interaction.
IntActiQ6ZMY6. 14 interactions.
STRINGi9606.ENSP00000348129.

Structurei

3D structure databases

ProteinModelPortaliQ6ZMY6.
SMRiQ6ZMY6. Positions 44-393.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati100 – 13940WD 1Add
BLAST
Repeati143 – 18240WD 2Add
BLAST
Repeati184 – 22441WD 3Add
BLAST
Repeati228 – 26740WD 4Add
BLAST
Repeati271 – 31040WD 5Add
BLAST
Repeati319 – 35840WD 6Add
BLAST
Repeati361 – 40040WD 7Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi452 – 4587Poly-Ser

Sequence similaritiesi

Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0266. Eukaryota.
ENOG410XP3K. LUCA.
GeneTreeiENSGT00810000125363.
HOGENOMiHOG000169116.
InParanoidiQ6ZMY6.
OMAiFCVDDTK.
PhylomeDBiQ6ZMY6.
TreeFamiTF300039.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR018391. PQQ_beta_propeller_repeat.
IPR002372. PQQ_repeat.
IPR011047. Quinoprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF01011. PQQ. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00564. PQQ. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50998. SSF50998. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 5 hits.
PS50082. WD_REPEATS_2. 6 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZMY6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASPPRCSPT AHDRECKLPP PSAPASEYCP GKLSWGTMAR ALGRFKLSIP
60 70 80 90 100
HTHLLATLDP LALDREPPPH LLPEKHQVPE KLIWGDQDPL SKIPFKILSG
110 120 130 140 150
HEHAVSTCHF CVDDTKLLSG SYDCTVKLWD PVDGSVVRDF EHRPKAPVVE
160 170 180 190 200
CSITGDSSRV IAASYDKTVR AWDLETGKLL WKVRYDTFIV SCKFSPDGKY
210 220 230 240 250
VVSGFDVDHG ICIMDAENIT TVSVIKDHHT RSITSCCFDP DSQRVASVSL
260 270 280 290 300
DRCIKIWDVT SQATLLTITK AHSNAISNCC FTFSGHFLCT SSWDKNLKIW
310 320 330 340 350
NVHTGEFRNC GACVTLMQGH EGSVSSCHFA RDSSFLISGG FDRTVAIWDV
360 370 380 390 400
AEGYRKLSLK GHNDWVMDVA ISNNKKWILS ASKDRTMRLW NIEEIDEIPL
410 420 430 440 450
VIKYKKAVGL KLKQCERCDR PFSIFKSDTS SEMFTQCVFC RIDTRGLPAD
460 470
TSSSSSSSER ENSPPPRGSK DD
Length:472
Mass (Da):52,621
Last modified:May 18, 2010 - v2
Checksum:iB525CCC29477F730
GO
Isoform 2 (identifier: Q6ZMY6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     415-472: CERCDRPFSIFKSDTSSEMFTQCVFCRIDTRGLPADTSSSSSSSERENSPPPRGSKDD → EKKEAYLKLKQG

Note: No experimental confirmation available.
Show »
Length:426
Mass (Da):47,617
Checksum:iC24E341B10CFDB51
GO

Sequence cautioni

The sequence AAH31227.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti166 – 1661D → H in a breast cancer sample; somatic mutation. 1 Publication
VAR_035892
Natural varianti310 – 3101C → R.1 Publication
Corresponds to variant rs11881580 [ dbSNP | Ensembl ].
VAR_032030

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei415 – 47258CERCD…GSKDD → EKKEAYLKLKQG in isoform 2. 1 PublicationVSP_024873Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131444 mRNA. Translation: BAD18589.1.
AC008738 Genomic DNA. No translation available.
BC031227 mRNA. Translation: AAH31227.2. Different initiation.
CCDSiCCDS12429.1. [Q6ZMY6-1]
RefSeqiNP_775750.3. NM_173479.3. [Q6ZMY6-1]
XP_011524753.1. XM_011526451.1. [Q6ZMY6-2]
UniGeneiHs.211046.

Genome annotation databases

EnsembliENST00000355868; ENSP00000348129; ENSG00000166359. [Q6ZMY6-1]
ENST00000361680; ENSP00000355148; ENSG00000166359. [Q6ZMY6-2]
GeneIDi126248.
KEGGihsa:126248.
UCSCiuc002nui.4. human. [Q6ZMY6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131444 mRNA. Translation: BAD18589.1.
AC008738 Genomic DNA. No translation available.
BC031227 mRNA. Translation: AAH31227.2. Different initiation.
CCDSiCCDS12429.1. [Q6ZMY6-1]
RefSeqiNP_775750.3. NM_173479.3. [Q6ZMY6-1]
XP_011524753.1. XM_011526451.1. [Q6ZMY6-2]
UniGeneiHs.211046.

3D structure databases

ProteinModelPortaliQ6ZMY6.
SMRiQ6ZMY6. Positions 44-393.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125970. 1 interaction.
IntActiQ6ZMY6. 14 interactions.
STRINGi9606.ENSP00000348129.

PTM databases

iPTMnetiQ6ZMY6.
PhosphoSiteiQ6ZMY6.

Polymorphism and mutation databases

BioMutaiWDR88.
DMDMi296453028.

Proteomic databases

PaxDbiQ6ZMY6.
PRIDEiQ6ZMY6.

Protocols and materials databases

DNASUi126248.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355868; ENSP00000348129; ENSG00000166359. [Q6ZMY6-1]
ENST00000361680; ENSP00000355148; ENSG00000166359. [Q6ZMY6-2]
GeneIDi126248.
KEGGihsa:126248.
UCSCiuc002nui.4. human. [Q6ZMY6-1]

Organism-specific databases

CTDi126248.
GeneCardsiWDR88.
H-InvDBHIX0202850.
HGNCiHGNC:26999. WDR88.
HPAiHPA041916.
neXtProtiNX_Q6ZMY6.
PharmGKBiPA162409139.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0266. Eukaryota.
ENOG410XP3K. LUCA.
GeneTreeiENSGT00810000125363.
HOGENOMiHOG000169116.
InParanoidiQ6ZMY6.
OMAiFCVDDTK.
PhylomeDBiQ6ZMY6.
TreeFamiTF300039.

Enzyme and pathway databases

SignaLinkiQ6ZMY6.

Miscellaneous databases

ChiTaRSiWDR88. human.
GenomeRNAii126248.
PROiQ6ZMY6.

Gene expression databases

BgeeiQ6ZMY6.
CleanExiHS_WDR88.
ExpressionAtlasiQ6ZMY6. baseline and differential.
GenevisibleiQ6ZMY6. HS.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR018391. PQQ_beta_propeller_repeat.
IPR002372. PQQ_repeat.
IPR011047. Quinoprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF01011. PQQ. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00564. PQQ. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50998. SSF50998. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 5 hits.
PS50082. WD_REPEATS_2. 6 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-310.
    Tissue: Testis.
  2. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  4. Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-166.

Entry informationi

Entry nameiWDR88_HUMAN
AccessioniPrimary (citable) accession number: Q6ZMY6
Secondary accession number(s): Q8NEF8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 18, 2010
Last modified: June 8, 2016
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.