Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat-containing protein 88

Gene

WDR88

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ6ZMY6.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 88
Alternative name(s):
PQQ repeat and WD repeat-containing protein
Gene namesi
Name:WDR88
Synonyms:PQWD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:26999. WDR88.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000166359.
PharmGKBiPA162409139.

Polymorphism and mutation databases

BioMutaiWDR88.
DMDMi296453028.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002856301 – 472WD repeat-containing protein 88Add BLAST472

Proteomic databases

PaxDbiQ6ZMY6.
PeptideAtlasiQ6ZMY6.
PRIDEiQ6ZMY6.

PTM databases

iPTMnetiQ6ZMY6.
PhosphoSitePlusiQ6ZMY6.

Expressioni

Gene expression databases

BgeeiENSG00000166359.
CleanExiHS_WDR88.
ExpressionAtlasiQ6ZMY6. baseline and differential.
GenevisibleiQ6ZMY6. HS.

Organism-specific databases

HPAiHPA041916.
HPA050336.

Interactioni

Protein-protein interaction databases

BioGridi125970. 1 interactor.
IntActiQ6ZMY6. 14 interactors.
STRINGi9606.ENSP00000348129.

Structurei

3D structure databases

ProteinModelPortaliQ6ZMY6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati100 – 139WD 1Add BLAST40
Repeati143 – 182WD 2Add BLAST40
Repeati184 – 224WD 3Add BLAST41
Repeati228 – 267WD 4Add BLAST40
Repeati271 – 310WD 5Add BLAST40
Repeati319 – 358WD 6Add BLAST40
Repeati361 – 400WD 7Add BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi452 – 458Poly-Ser7

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0266. Eukaryota.
ENOG410XP3K. LUCA.
GeneTreeiENSGT00890000139543.
HOGENOMiHOG000169116.
InParanoidiQ6ZMY6.
OMAiACVTLMQ.
OrthoDBiEOG091G0FFA.
PhylomeDBiQ6ZMY6.
TreeFamiTF300039.

Family and domain databases

InterProiView protein in InterPro
IPR020472. G-protein_beta_WD-40_rep.
IPR018391. PQQ_beta_propeller_repeat.
IPR002372. PQQ_repeat.
IPR011047. Quinoprotein_ADH-like_supfam.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
PfamiView protein in Pfam
PF01011. PQQ. 1 hit.
PF00400. WD40. 5 hits.
PRINTSiPR00320. GPROTEINBRPT.
SMARTiView protein in SMART
SM00564. PQQ. 1 hit.
SM00320. WD40. 7 hits.
SUPFAMiSSF50998. SSF50998. 1 hit.
PROSITEiView protein in PROSITE
PS00678. WD_REPEATS_1. 5 hits.
PS50082. WD_REPEATS_2. 6 hits.
PS50294. WD_REPEATS_REGION. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZMY6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASPPRCSPT AHDRECKLPP PSAPASEYCP GKLSWGTMAR ALGRFKLSIP
60 70 80 90 100
HTHLLATLDP LALDREPPPH LLPEKHQVPE KLIWGDQDPL SKIPFKILSG
110 120 130 140 150
HEHAVSTCHF CVDDTKLLSG SYDCTVKLWD PVDGSVVRDF EHRPKAPVVE
160 170 180 190 200
CSITGDSSRV IAASYDKTVR AWDLETGKLL WKVRYDTFIV SCKFSPDGKY
210 220 230 240 250
VVSGFDVDHG ICIMDAENIT TVSVIKDHHT RSITSCCFDP DSQRVASVSL
260 270 280 290 300
DRCIKIWDVT SQATLLTITK AHSNAISNCC FTFSGHFLCT SSWDKNLKIW
310 320 330 340 350
NVHTGEFRNC GACVTLMQGH EGSVSSCHFA RDSSFLISGG FDRTVAIWDV
360 370 380 390 400
AEGYRKLSLK GHNDWVMDVA ISNNKKWILS ASKDRTMRLW NIEEIDEIPL
410 420 430 440 450
VIKYKKAVGL KLKQCERCDR PFSIFKSDTS SEMFTQCVFC RIDTRGLPAD
460 470
TSSSSSSSER ENSPPPRGSK DD
Length:472
Mass (Da):52,621
Last modified:May 18, 2010 - v2
Checksum:iB525CCC29477F730
GO
Isoform 2 (identifier: Q6ZMY6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     415-472: CERCDRPFSIFKSDTSSEMFTQCVFCRIDTRGLPADTSSSSSSSERENSPPPRGSKDD → EKKEAYLKLKQG

Note: No experimental confirmation available.
Show »
Length:426
Mass (Da):47,617
Checksum:iC24E341B10CFDB51
GO

Sequence cautioni

The sequence AAH31227 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035892166D → H in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_032030310C → R1 PublicationCorresponds to variant dbSNP:rs11881580Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024873415 – 472CERCD…GSKDD → EKKEAYLKLKQG in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131444 mRNA. Translation: BAD18589.1.
AC008738 Genomic DNA. No translation available.
BC031227 mRNA. Translation: AAH31227.2. Different initiation.
CCDSiCCDS12429.1. [Q6ZMY6-1]
RefSeqiNP_775750.3. NM_173479.3. [Q6ZMY6-1]
UniGeneiHs.211046.

Genome annotation databases

EnsembliENST00000355868; ENSP00000348129; ENSG00000166359. [Q6ZMY6-1]
ENST00000361680; ENSP00000355148; ENSG00000166359. [Q6ZMY6-2]
GeneIDi126248.
KEGGihsa:126248.
UCSCiuc002nui.4. human. [Q6ZMY6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiWDR88_HUMAN
AccessioniPrimary (citable) accession number: Q6ZMY6
Secondary accession number(s): Q8NEF8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 18, 2010
Last modified: August 30, 2017
This is version 112 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations