Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lipase member I

Gene

LIPI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Hydrolyzes specifically phosphatidic acid (PA) to produce 2-acyl lysophosphatidic acid (LPA; a potent bioactive lipid mediator) and fatty acid. Does not hydrolyze other phospholipids, like phosphatidylserine (PS), phosphatidylcholine (PC) and phosphatidylethanolamine (PE) or triacylglycerol (TG).1 Publication

Enzyme regulationi

Inhibited by sodium vanadate.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei159 – 1591Nucleophile
Active sitei183 – 1831Charge relay systemBy similarity
Active sitei253 – 2531Charge relay systemBy similarity

GO - Molecular functioni

  • carboxylic ester hydrolase activity Source: InterPro
  • heparin binding Source: UniProtKB
  • phospholipase activity Source: UniProtKB

GO - Biological processi

  • lipid catabolic process Source: UniProtKB
  • lipid digestion Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Heparin-binding

Enzyme and pathway databases

BRENDAi3.1.1.32. 2681.
ReactomeiR-HSA-192456. Digestion of dietary lipid.

Protein family/group databases

ESTHERihuman-LIPI. Phospholipase.

Chemistry

SwissLipidsiSLP:000000626.

Names & Taxonomyi

Protein namesi
Recommended name:
Lipase member I (EC:3.1.1.-)
Short name:
LIPI
Alternative name(s):
Cancer/testis antigen 17
Short name:
CT17
LPD lipase
Membrane-associated phosphatidic acid-selective phospholipase A1-beta
Short name:
mPA-PLA1 beta
Gene namesi
Name:LIPI
Synonyms:LPDL
ORF Names:PRED5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 21

Organism-specific databases

HGNCiHGNC:18821. LIPI.

Subcellular locationi

Isoform 1 :
Isoform 2 :
  • Membrane

  • Note: May associate with lipid draft.

GO - Cellular componenti

  • extracellular region Source: UniProtKB-SubCell
  • extracellular space Source: UniProtKB
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Secreted

Pathology & Biotechi

Involvement in diseasei

Hypertriglyceridemia, familial (FHTR)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA common inherited disorder in which the concentration of very low density lipoprotein (VLDL) is elevated in the plasma. This leads to increased risk of heart disease, obesity, and pancreatitis.
See also OMIM:145750
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti55 – 551C → Y in FHTR. 1 Publication
Corresponds to variant rs11909217 [ dbSNP | Ensembl ].
VAR_023760

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi159 – 1591S → A: No activity. 1 Publication

Keywords - Diseasei

Disease mutation

Organism-specific databases

MalaCardsiLIPI.
MIMi145750. phenotype.
Orphaneti413. Hyperlipoproteinemia type 4.
PharmGKBiPA38695.

Polymorphism and mutation databases

BioMutaiLIPI.
DMDMi81170675.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1515Sequence analysisAdd
BLAST
Chaini16 – 460445Lipase member IPRO_0000042779Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi63 – 631N-linked (GlcNAc...)Sequence analysis
Disulfide bondi238 ↔ 251By similarity
Disulfide bondi275 ↔ 286By similarity
Disulfide bondi289 ↔ 297By similarity
Glycosylationi396 – 3961N-linked (GlcNAc...)Sequence analysis
Disulfide bondi436 ↔ 455By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ6XZB0.
PRIDEiQ6XZB0.

PTM databases

iPTMnetiQ6XZB0.
PhosphoSiteiQ6XZB0.

Expressioni

Tissue specificityi

Expressed in testis. Expressed exclusively at the connecting piece of the sperm.2 Publications

Gene expression databases

BgeeiQ6XZB0.
CleanExiHS_LIPI.
ExpressionAtlasiQ6XZB0. baseline and differential.
GenevisibleiQ6XZB0. HS.

Organism-specific databases

HPAiHPA029950.

Interactioni

Subunit structurei

Interacts with heparin with a high affinity.

Protein-protein interaction databases

STRINGi9606.ENSP00000343331.

Structurei

3D structure databases

ProteinModelPortaliQ6XZB0.
SMRiQ6XZB0. Positions 40-353.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AB hydrolase superfamily. Lipase family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IKYJ. Eukaryota.
ENOG4111AHY. LUCA.
HOGENOMiHOG000234386.
HOVERGENiHBG080640.
InParanoidiQ6XZB0.
KOiK19404.
OrthoDBiEOG79PJP2.
PhylomeDBiQ6XZB0.
TreeFamiTF324997.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR016272. Lipase_LIPH.
IPR013818. Lipase_N.
IPR000734. TAG_lipase.
[Graphical view]
PANTHERiPTHR11610. PTHR11610. 1 hit.
PfamiPF00151. Lipase. 1 hit.
[Graphical view]
PIRSFiPIRSF000865. Lipoprotein_lipase_LIPH. 1 hit.
PRINTSiPR00821. TAGLIPASE.
SUPFAMiSSF53474. SSF53474. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6XZB0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRVYIFLCLM CWVRSDNKRP CLEFSQLSVK DSFRDLFIPR IETILMMYTR
60 70 80 90 100
NNLNCAEPLF EQNNSLNVNF NTQKKTVWLI HGYRPVGSIP LWLQNFVRIL
110 120 130 140 150
LNEEDMNVIV VDWSRGATTF IYNRAVKNTR KVAVSLSVHI KNLLKHGASL
160 170 180 190 200
DNFHFIGVSL GAHISGFVGK IFHGQLGRIT GLDPAGPRFS RKPPYSRLDY
210 220 230 240 250
TDAKFVDVIH SDSNGLGIQE PLGHIDFYPN GGNKQPGCPK SIFSGIQFIK
260 270 280 290 300
CNHQRAVHLF MASLETNCNF ISFPCRSYKD YKTSLCVDCD CFKEKSCPRL
310 320 330 340 350
GYQAKLFKGV LKERMEGRPL RTTVFLDTSG TYPFCTYYFV LSIIVPDKTM
360 370 380 390 400
MDGSFSFKLL NQLGMIEEPR LYEKNKPFYK LQEVKILAQF YNDFVNISSI
410 420 430 440 450
GLTYFQSSNL QCSTCTYKIQ RLMLKSLTYP ERPPLCRYNI VLKDREEVFL
460
NPNTCTPKNT
Length:460
Mass (Da):52,992
Last modified:November 8, 2005 - v2
Checksum:i397F63050DBB6D25
GO
Isoform 2 (identifier: Q6XZB0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MRVYIFLCLMCWV → MLLKCLHNNLCQKYSAHAFQFSPRNVLWLLVVCL

Show »
Length:481
Mass (Da):55,318
Checksum:iB13C273132EB8998
GO
Isoform 3 (identifier: Q6XZB0-3) [UniParc]FASTAAdd to basket

Also known as: deltaE7.2

The sequence of this isoform differs from the canonical sequence as follows:
     330-336: GTYPFCT → A

Show »
Length:454
Mass (Da):52,293
Checksum:iB2FFE5EB5FE591A4
GO
Isoform 4 (identifier: Q6XZB0-4) [UniParc]FASTAAdd to basket

Also known as: deltaE6.1

The sequence of this isoform differs from the canonical sequence as follows:
     245-279: Missing.

Show »
Length:425
Mass (Da):48,905
Checksum:i657063AB346A9CD9
GO
Isoform 5 (identifier: Q6XZB0-5) [UniParc]FASTAAdd to basket

Also known as: deltaE5

The sequence of this isoform differs from the canonical sequence as follows:
     215-244: Missing.

Show »
Length:430
Mass (Da):49,838
Checksum:i950EFD220143281A
GO
Isoform 6 (identifier: Q6XZB0-6) [UniParc]FASTAAdd to basket

Also known as: deltaE8-9

The sequence of this isoform differs from the canonical sequence as follows:
     336-375: TYYFVLSIIV...IEEPRLYEKN → NHHFAGIILY...MPSSIKCTCL
     376-460: Missing.

Show »
Length:375
Mass (Da):43,005
Checksum:i02E18ECA4D84E285
GO
Isoform 7 (identifier: Q6XZB0-7) [UniParc]FASTAAdd to basket

Also known as: 7B+

The sequence of this isoform differs from the canonical sequence as follows:
     336-368: TYYFVLSIIVPDKTMMDGSFSFKLLNQLGMIEE → NKPVFRIYLFNTSPYPLLAGRLFHLSCLRVVKN
     369-460: Missing.

Show »
Length:368
Mass (Da):42,135
Checksum:i0D5DC5B861667854
GO
Isoform 8 (identifier: Q6XZB0-8) [UniParc]FASTAAdd to basket

Also known as: deltaE2-3

The sequence of this isoform differs from the canonical sequence as follows:
     16-180: Missing.

Show »
Length:295
Mass (Da):34,110
Checksum:iBA9AE355BA7D2717
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti421 – 4211R → S in AEL12688 (PubMed:21132378).Curated
Sequence conflicti421 – 4211R → S in AEL12690 (PubMed:21132378).Curated
Sequence conflicti421 – 4211R → S in AEL12691 (PubMed:21132378).Curated
Sequence conflicti421 – 4211R → S in AEL12692 (PubMed:21132378).Curated
Sequence conflicti421 – 4211R → S in AEL12693 (PubMed:21132378).Curated
Sequence conflicti421 – 4211R → S in AEL12694 (PubMed:21132378).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti55 – 551C → Y in FHTR. 1 Publication
Corresponds to variant rs11909217 [ dbSNP | Ensembl ].
VAR_023760
Natural varianti364 – 3641G → E.1 Publication
Corresponds to variant rs74369337 [ dbSNP | Ensembl ].
VAR_023761
Natural varianti431 – 4311E → K.1 Publication
Corresponds to variant rs2822432 [ dbSNP | Ensembl ].
VAR_023762
Natural varianti444 – 4441D → E.1 Publication
Corresponds to variant rs7278737 [ dbSNP | Ensembl ].
VAR_023763

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1313MRVYI…LMCWV → MLLKCLHNNLCQKYSAHAFQ FSPRNVLWLLVVCL in isoform 2. 1 PublicationVSP_016090Add
BLAST
Alternative sequencei16 – 180165Missing in isoform 8. 1 PublicationVSP_053896Add
BLAST
Alternative sequencei215 – 24430Missing in isoform 5. 1 PublicationVSP_053897Add
BLAST
Alternative sequencei245 – 27935Missing in isoform 4. 1 PublicationVSP_053898Add
BLAST
Alternative sequencei330 – 3367GTYPFCT → A in isoform 3. 1 PublicationVSP_053899
Alternative sequencei336 – 37540TYYFV…LYEKN → NHHFAGIILYLKNERKCFLI QTHVHQRTHKMPSSIKCTCL in isoform 6. 1 PublicationVSP_053900Add
BLAST
Alternative sequencei336 – 36833TYYFV…GMIEE → NKPVFRIYLFNTSPYPLLAG RLFHLSCLRVVKN in isoform 7. 1 PublicationVSP_053901Add
BLAST
Alternative sequencei369 – 46092Missing in isoform 7. 1 PublicationVSP_053902Add
BLAST
Alternative sequencei376 – 46085Missing in isoform 6. 1 PublicationVSP_053903Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY197607 mRNA. Translation: AAP37476.1.
JN387910 mRNA. Translation: AEL12688.1.
JN387911 mRNA. Translation: AEL12689.1.
JN387912 mRNA. Translation: AEL12690.1.
JN387913 mRNA. Translation: AEL12691.1.
JN387914 mRNA. Translation: AEL12692.1.
JN387915 mRNA. Translation: AEL12693.1.
JN387916 mRNA. Translation: AEL12694.1.
AF130358 Genomic DNA. No translation available.
AL078615 Genomic DNA. No translation available.
AP001347 Genomic DNA. No translation available.
CCDSiCCDS13564.1. [Q6XZB0-2]
RefSeqiNP_001289927.1. NM_001302998.1.
NP_001289928.1. NM_001302999.1.
NP_001289929.1. NM_001303000.1.
NP_001289930.1. NM_001303001.1.
NP_945347.2. NM_198996.3.
UniGeneiHs.139907.

Genome annotation databases

EnsembliENST00000344577; ENSP00000343331; ENSG00000188992.
ENST00000536861; ENSP00000440381; ENSG00000188992.
GeneIDi149998.
KEGGihsa:149998.
UCSCiuc002yjm.4. human. [Q6XZB0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY197607 mRNA. Translation: AAP37476.1.
JN387910 mRNA. Translation: AEL12688.1.
JN387911 mRNA. Translation: AEL12689.1.
JN387912 mRNA. Translation: AEL12690.1.
JN387913 mRNA. Translation: AEL12691.1.
JN387914 mRNA. Translation: AEL12692.1.
JN387915 mRNA. Translation: AEL12693.1.
JN387916 mRNA. Translation: AEL12694.1.
AF130358 Genomic DNA. No translation available.
AL078615 Genomic DNA. No translation available.
AP001347 Genomic DNA. No translation available.
CCDSiCCDS13564.1. [Q6XZB0-2]
RefSeqiNP_001289927.1. NM_001302998.1.
NP_001289928.1. NM_001302999.1.
NP_001289929.1. NM_001303000.1.
NP_001289930.1. NM_001303001.1.
NP_945347.2. NM_198996.3.
UniGeneiHs.139907.

3D structure databases

ProteinModelPortaliQ6XZB0.
SMRiQ6XZB0. Positions 40-353.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000343331.

Chemistry

SwissLipidsiSLP:000000626.

Protein family/group databases

ESTHERihuman-LIPI. Phospholipase.

PTM databases

iPTMnetiQ6XZB0.
PhosphoSiteiQ6XZB0.

Polymorphism and mutation databases

BioMutaiLIPI.
DMDMi81170675.

Proteomic databases

PaxDbiQ6XZB0.
PRIDEiQ6XZB0.

Protocols and materials databases

DNASUi149998.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000344577; ENSP00000343331; ENSG00000188992.
ENST00000536861; ENSP00000440381; ENSG00000188992.
GeneIDi149998.
KEGGihsa:149998.
UCSCiuc002yjm.4. human. [Q6XZB0-1]

Organism-specific databases

CTDi149998.
GeneCardsiLIPI.
HGNCiHGNC:18821. LIPI.
HPAiHPA029950.
MalaCardsiLIPI.
MIMi145750. phenotype.
609252. gene.
neXtProtiNX_Q6XZB0.
Orphaneti413. Hyperlipoproteinemia type 4.
PharmGKBiPA38695.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKYJ. Eukaryota.
ENOG4111AHY. LUCA.
HOGENOMiHOG000234386.
HOVERGENiHBG080640.
InParanoidiQ6XZB0.
KOiK19404.
OrthoDBiEOG79PJP2.
PhylomeDBiQ6XZB0.
TreeFamiTF324997.

Enzyme and pathway databases

BRENDAi3.1.1.32. 2681.
ReactomeiR-HSA-192456. Digestion of dietary lipid.

Miscellaneous databases

ChiTaRSiLIPI. human.
GenomeRNAii149998.
PROiQ6XZB0.
SOURCEiSearch...

Gene expression databases

BgeeiQ6XZB0.
CleanExiHS_LIPI.
ExpressionAtlasiQ6XZB0. baseline and differential.
GenevisibleiQ6XZB0. HS.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR016272. Lipase_LIPH.
IPR013818. Lipase_N.
IPR000734. TAG_lipase.
[Graphical view]
PANTHERiPTHR11610. PTHR11610. 1 hit.
PfamiPF00151. Lipase. 1 hit.
[Graphical view]
PIRSFiPIRSF000865. Lipoprotein_lipase_LIPH. 1 hit.
PRINTSiPR00821. TAGLIPASE.
SUPFAMiSSF53474. SSF53474. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Biochemical and molecular characterization of two phosphatidic acid-selective phospholipase A1s, mPA-PLA1alpha and mPA-PLA1beta."
    Hiramatsu T., Sonoda H., Takanezawa Y., Morikawa R., Ishida M., Kasahara K., Sanai Y., Taguchi R., Aoki J., Arai H.
    J. Biol. Chem. 278:49438-49447(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, ENZYME REGULATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF SER-159.
  2. "Identification of a novel lipase gene mutated in lpd mice with hypertriglyceridemia and associated with dyslipidemia in humans."
    Wen X.-Y., Hegele R.A., Wang J., Wang D.Y., Cheung J., Wilson M., Yahyapour M., Bai Y., Zhuang L., Skaug J., Young T.K., Connelly P.W., Koop B.F., Tsui L.-C., Stewart A.K.
    Hum. Mol. Genet. 12:1131-1143(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS GLU-364; LYS-431 AND GLU-444, INVOLVEMENT IN FHTR, VARIANT FHTR TYR-55.
  3. "Expression of multiple membrane-associated phospholipase A1 beta transcript variants and lysophosphatidic acid receptors in Ewing tumor cells."
    Schmiedel B.J., Hutter C., Hesse M., Staege M.S.
    Mol. Biol. Rep. 38:4619-4628(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3; 4; 5; 6; 7 AND 8), ALTERNATIVE SPLICING.
  4. "The DNA sequence of human chromosome 21."
    Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A.
    , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
    Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiLIPI_HUMAN
AccessioniPrimary (citable) accession number: Q6XZB0
Secondary accession number(s): G1JSG3
, G1JSG4, G1JSG5, G1JSG6, G1JSG7, G1JSG8, G1JSG9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: November 8, 2005
Last modified: June 8, 2016
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.