Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lipase member I

Gene

LIPI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Hydrolyzes specifically phosphatidic acid (PA) to produce 2-acyl lysophosphatidic acid (LPA; a potent bioactive lipid mediator) and fatty acid. Does not hydrolyze other phospholipids, like phosphatidylserine (PS), phosphatidylcholine (PC) and phosphatidylethanolamine (PE) or triacylglycerol (TG).1 Publication

Enzyme regulationi

Inhibited by sodium vanadate.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei159Nucleophile1
Active sitei183Charge relay systemBy similarity1
Active sitei253Charge relay systemBy similarity1

GO - Molecular functioni

  • carboxylic ester hydrolase activity Source: InterPro
  • heparin binding Source: UniProtKB
  • phospholipase activity Source: UniProtKB

GO - Biological processi

  • lipid catabolic process Source: UniProtKB
  • lipid digestion Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Heparin-binding

Enzyme and pathway databases

BRENDAi3.1.1.32. 2681.
ReactomeiR-HSA-192456. Digestion of dietary lipid.

Protein family/group databases

ESTHERihuman-LIPI. Phospholipase.

Chemistry databases

SwissLipidsiSLP:000000626.

Names & Taxonomyi

Protein namesi
Recommended name:
Lipase member I (EC:3.1.1.-)
Short name:
LIPI
Alternative name(s):
Cancer/testis antigen 17
Short name:
CT17
LPD lipase
Membrane-associated phosphatidic acid-selective phospholipase A1-beta
Short name:
mPA-PLA1 beta
Gene namesi
Name:LIPI
Synonyms:LPDL
ORF Names:PRED5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 21

Organism-specific databases

HGNCiHGNC:18821. LIPI.

Subcellular locationi

Isoform 1 :
Isoform 2 :
  • Membrane

  • Note: May associate with lipid draft.

GO - Cellular componenti

  • extracellular region Source: UniProtKB-SubCell
  • extracellular space Source: UniProtKB
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Secreted

Pathology & Biotechi

Involvement in diseasei

Hypertriglyceridemia, familial (FHTR)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA common inherited disorder in which the concentration of very low density lipoprotein (VLDL) is elevated in the plasma. This leads to increased risk of heart disease, obesity, and pancreatitis.
See also OMIM:145750
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02376055C → Y in FHTR. 1 PublicationCorresponds to variant rs11909217dbSNPEnsembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi159S → A: No activity. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi149998.
MalaCardsiLIPI.
MIMi145750. phenotype.
Orphaneti413. Hyperlipoproteinemia type 4.
PharmGKBiPA38695.

Polymorphism and mutation databases

BioMutaiLIPI.
DMDMi81170675.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 15Sequence analysisAdd BLAST15
ChainiPRO_000004277916 – 460Lipase member IAdd BLAST445

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi63N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi238 ↔ 251By similarity
Disulfide bondi275 ↔ 286By similarity
Disulfide bondi289 ↔ 297By similarity
Glycosylationi396N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi436 ↔ 455By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ6XZB0.
PRIDEiQ6XZB0.

PTM databases

iPTMnetiQ6XZB0.
PhosphoSitePlusiQ6XZB0.

Expressioni

Tissue specificityi

Expressed in testis. Expressed exclusively at the connecting piece of the sperm.2 Publications

Gene expression databases

BgeeiENSG00000188992.
CleanExiHS_LIPI.
ExpressionAtlasiQ6XZB0. baseline and differential.
GenevisibleiQ6XZB0. HS.

Organism-specific databases

HPAiHPA029950.

Interactioni

Subunit structurei

Interacts with heparin with a high affinity.

Protein-protein interaction databases

STRINGi9606.ENSP00000343331.

Structurei

3D structure databases

ProteinModelPortaliQ6XZB0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AB hydrolase superfamily. Lipase family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IKYJ. Eukaryota.
ENOG4111AHY. LUCA.
HOGENOMiHOG000234386.
HOVERGENiHBG080640.
InParanoidiQ6XZB0.
KOiK19404.
OrthoDBiEOG091G0680.
PhylomeDBiQ6XZB0.
TreeFamiTF324997.

Family and domain databases

CDDicd00707. Pancreat_lipase_like. 1 hit.
Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR013818. Lipase/vitellogenin.
IPR016272. Lipase_LIPH.
IPR033906. Lipase_N.
IPR000734. TAG_lipase.
[Graphical view]
PANTHERiPTHR11610. PTHR11610. 1 hit.
PfamiPF00151. Lipase. 1 hit.
[Graphical view]
PIRSFiPIRSF000865. Lipoprotein_lipase_LIPH. 1 hit.
PRINTSiPR00821. TAGLIPASE.
SUPFAMiSSF53474. SSF53474. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6XZB0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRVYIFLCLM CWVRSDNKRP CLEFSQLSVK DSFRDLFIPR IETILMMYTR
60 70 80 90 100
NNLNCAEPLF EQNNSLNVNF NTQKKTVWLI HGYRPVGSIP LWLQNFVRIL
110 120 130 140 150
LNEEDMNVIV VDWSRGATTF IYNRAVKNTR KVAVSLSVHI KNLLKHGASL
160 170 180 190 200
DNFHFIGVSL GAHISGFVGK IFHGQLGRIT GLDPAGPRFS RKPPYSRLDY
210 220 230 240 250
TDAKFVDVIH SDSNGLGIQE PLGHIDFYPN GGNKQPGCPK SIFSGIQFIK
260 270 280 290 300
CNHQRAVHLF MASLETNCNF ISFPCRSYKD YKTSLCVDCD CFKEKSCPRL
310 320 330 340 350
GYQAKLFKGV LKERMEGRPL RTTVFLDTSG TYPFCTYYFV LSIIVPDKTM
360 370 380 390 400
MDGSFSFKLL NQLGMIEEPR LYEKNKPFYK LQEVKILAQF YNDFVNISSI
410 420 430 440 450
GLTYFQSSNL QCSTCTYKIQ RLMLKSLTYP ERPPLCRYNI VLKDREEVFL
460
NPNTCTPKNT
Length:460
Mass (Da):52,992
Last modified:November 8, 2005 - v2
Checksum:i397F63050DBB6D25
GO
Isoform 2 (identifier: Q6XZB0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MRVYIFLCLMCWV → MLLKCLHNNLCQKYSAHAFQFSPRNVLWLLVVCL

Show »
Length:481
Mass (Da):55,318
Checksum:iB13C273132EB8998
GO
Isoform 3 (identifier: Q6XZB0-3) [UniParc]FASTAAdd to basket
Also known as: deltaE7.2

The sequence of this isoform differs from the canonical sequence as follows:
     330-336: GTYPFCT → A

Show »
Length:454
Mass (Da):52,293
Checksum:iB2FFE5EB5FE591A4
GO
Isoform 4 (identifier: Q6XZB0-4) [UniParc]FASTAAdd to basket
Also known as: deltaE6.1

The sequence of this isoform differs from the canonical sequence as follows:
     245-279: Missing.

Show »
Length:425
Mass (Da):48,905
Checksum:i657063AB346A9CD9
GO
Isoform 5 (identifier: Q6XZB0-5) [UniParc]FASTAAdd to basket
Also known as: deltaE5

The sequence of this isoform differs from the canonical sequence as follows:
     215-244: Missing.

Show »
Length:430
Mass (Da):49,838
Checksum:i950EFD220143281A
GO
Isoform 6 (identifier: Q6XZB0-6) [UniParc]FASTAAdd to basket
Also known as: deltaE8-9

The sequence of this isoform differs from the canonical sequence as follows:
     336-375: TYYFVLSIIV...IEEPRLYEKN → NHHFAGIILY...MPSSIKCTCL
     376-460: Missing.

Show »
Length:375
Mass (Da):43,005
Checksum:i02E18ECA4D84E285
GO
Isoform 7 (identifier: Q6XZB0-7) [UniParc]FASTAAdd to basket
Also known as: 7B+

The sequence of this isoform differs from the canonical sequence as follows:
     336-368: TYYFVLSIIVPDKTMMDGSFSFKLLNQLGMIEE → NKPVFRIYLFNTSPYPLLAGRLFHLSCLRVVKN
     369-460: Missing.

Show »
Length:368
Mass (Da):42,135
Checksum:i0D5DC5B861667854
GO
Isoform 8 (identifier: Q6XZB0-8) [UniParc]FASTAAdd to basket
Also known as: deltaE2-3

The sequence of this isoform differs from the canonical sequence as follows:
     16-180: Missing.

Show »
Length:295
Mass (Da):34,110
Checksum:iBA9AE355BA7D2717
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti421R → S in AEL12688 (PubMed:21132378).Curated1
Sequence conflicti421R → S in AEL12690 (PubMed:21132378).Curated1
Sequence conflicti421R → S in AEL12691 (PubMed:21132378).Curated1
Sequence conflicti421R → S in AEL12692 (PubMed:21132378).Curated1
Sequence conflicti421R → S in AEL12693 (PubMed:21132378).Curated1
Sequence conflicti421R → S in AEL12694 (PubMed:21132378).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02376055C → Y in FHTR. 1 PublicationCorresponds to variant rs11909217dbSNPEnsembl.1
Natural variantiVAR_023761364G → E.1 PublicationCorresponds to variant rs74369337dbSNPEnsembl.1
Natural variantiVAR_023762431E → K.1 PublicationCorresponds to variant rs2822432dbSNPEnsembl.1
Natural variantiVAR_023763444D → E.1 PublicationCorresponds to variant rs7278737dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0160901 – 13MRVYI…LMCWV → MLLKCLHNNLCQKYSAHAFQ FSPRNVLWLLVVCL in isoform 2. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_05389616 – 180Missing in isoform 8. 1 PublicationAdd BLAST165
Alternative sequenceiVSP_053897215 – 244Missing in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_053898245 – 279Missing in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_053899330 – 336GTYPFCT → A in isoform 3. 1 Publication7
Alternative sequenceiVSP_053900336 – 375TYYFV…LYEKN → NHHFAGIILYLKNERKCFLI QTHVHQRTHKMPSSIKCTCL in isoform 6. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_053901336 – 368TYYFV…GMIEE → NKPVFRIYLFNTSPYPLLAG RLFHLSCLRVVKN in isoform 7. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_053902369 – 460Missing in isoform 7. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_053903376 – 460Missing in isoform 6. 1 PublicationAdd BLAST85

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY197607 mRNA. Translation: AAP37476.1.
JN387910 mRNA. Translation: AEL12688.1.
JN387911 mRNA. Translation: AEL12689.1.
JN387912 mRNA. Translation: AEL12690.1.
JN387913 mRNA. Translation: AEL12691.1.
JN387914 mRNA. Translation: AEL12692.1.
JN387915 mRNA. Translation: AEL12693.1.
JN387916 mRNA. Translation: AEL12694.1.
AF130358 Genomic DNA. No translation available.
AL078615 Genomic DNA. No translation available.
AP001347 Genomic DNA. No translation available.
CCDSiCCDS13564.1. [Q6XZB0-2]
RefSeqiNP_001289927.1. NM_001302998.1.
NP_001289928.1. NM_001302999.1.
NP_001289929.1. NM_001303000.1.
NP_001289930.1. NM_001303001.1.
NP_945347.2. NM_198996.3.
UniGeneiHs.139907.

Genome annotation databases

EnsembliENST00000344577; ENSP00000343331; ENSG00000188992.
ENST00000536861; ENSP00000440381; ENSG00000188992.
GeneIDi149998.
KEGGihsa:149998.
UCSCiuc002yjm.4. human. [Q6XZB0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY197607 mRNA. Translation: AAP37476.1.
JN387910 mRNA. Translation: AEL12688.1.
JN387911 mRNA. Translation: AEL12689.1.
JN387912 mRNA. Translation: AEL12690.1.
JN387913 mRNA. Translation: AEL12691.1.
JN387914 mRNA. Translation: AEL12692.1.
JN387915 mRNA. Translation: AEL12693.1.
JN387916 mRNA. Translation: AEL12694.1.
AF130358 Genomic DNA. No translation available.
AL078615 Genomic DNA. No translation available.
AP001347 Genomic DNA. No translation available.
CCDSiCCDS13564.1. [Q6XZB0-2]
RefSeqiNP_001289927.1. NM_001302998.1.
NP_001289928.1. NM_001302999.1.
NP_001289929.1. NM_001303000.1.
NP_001289930.1. NM_001303001.1.
NP_945347.2. NM_198996.3.
UniGeneiHs.139907.

3D structure databases

ProteinModelPortaliQ6XZB0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000343331.

Chemistry databases

SwissLipidsiSLP:000000626.

Protein family/group databases

ESTHERihuman-LIPI. Phospholipase.

PTM databases

iPTMnetiQ6XZB0.
PhosphoSitePlusiQ6XZB0.

Polymorphism and mutation databases

BioMutaiLIPI.
DMDMi81170675.

Proteomic databases

PaxDbiQ6XZB0.
PRIDEiQ6XZB0.

Protocols and materials databases

DNASUi149998.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000344577; ENSP00000343331; ENSG00000188992.
ENST00000536861; ENSP00000440381; ENSG00000188992.
GeneIDi149998.
KEGGihsa:149998.
UCSCiuc002yjm.4. human. [Q6XZB0-1]

Organism-specific databases

CTDi149998.
DisGeNETi149998.
GeneCardsiLIPI.
HGNCiHGNC:18821. LIPI.
HPAiHPA029950.
MalaCardsiLIPI.
MIMi145750. phenotype.
609252. gene.
neXtProtiNX_Q6XZB0.
Orphaneti413. Hyperlipoproteinemia type 4.
PharmGKBiPA38695.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKYJ. Eukaryota.
ENOG4111AHY. LUCA.
HOGENOMiHOG000234386.
HOVERGENiHBG080640.
InParanoidiQ6XZB0.
KOiK19404.
OrthoDBiEOG091G0680.
PhylomeDBiQ6XZB0.
TreeFamiTF324997.

Enzyme and pathway databases

BRENDAi3.1.1.32. 2681.
ReactomeiR-HSA-192456. Digestion of dietary lipid.

Miscellaneous databases

ChiTaRSiLIPI. human.
GenomeRNAii149998.
PROiQ6XZB0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000188992.
CleanExiHS_LIPI.
ExpressionAtlasiQ6XZB0. baseline and differential.
GenevisibleiQ6XZB0. HS.

Family and domain databases

CDDicd00707. Pancreat_lipase_like. 1 hit.
Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR013818. Lipase/vitellogenin.
IPR016272. Lipase_LIPH.
IPR033906. Lipase_N.
IPR000734. TAG_lipase.
[Graphical view]
PANTHERiPTHR11610. PTHR11610. 1 hit.
PfamiPF00151. Lipase. 1 hit.
[Graphical view]
PIRSFiPIRSF000865. Lipoprotein_lipase_LIPH. 1 hit.
PRINTSiPR00821. TAGLIPASE.
SUPFAMiSSF53474. SSF53474. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiLIPI_HUMAN
AccessioniPrimary (citable) accession number: Q6XZB0
Secondary accession number(s): G1JSG3
, G1JSG4, G1JSG5, G1JSG6, G1JSG7, G1JSG8, G1JSG9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: November 8, 2005
Last modified: November 30, 2016
This is version 119 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.