Q6XPS3 (TPTE2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 EC=3.1.3.67 Alternative name(s): Lipid phosphatase TPIP TPTE and PTEN homologous inositol lipid phosphatase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 522 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | Phosphatidylinositol 3,4,5-trisphosphate + H2O = phosphatidylinositol 4,5-bisphosphate + phosphate. |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.1. |
| Tissue specificity | Isoform 3 is expressed in testis, brain and stomach while isoform 4 seems to be testis-specific. Ref.1 |
| Sequence similarities | Contains 1 C2 tensin-type domain. Contains 1 phosphatase tensin-type domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Hydrolase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | ion channel activity Inferred from electronic annotation. Source: InterPro phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activityInferred from electronic annotation. Source: EC protein tyrosine phosphatase activityInferred from electronic annotation. Source: InterPro protein tyrosine/serine/threonine phosphatase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6XPS3-1) Also known as: TPIP gamma; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6XPS3-2) The sequence of this isoform differs from the canonical sequence as follows: 132-171: Missing. | ||||||
| Isoform 3 (identifier: Q6XPS3-3) Also known as: TPIP alpha; The sequence of this isoform differs from the canonical sequence as follows: 40-77: SMLERLSKFEVEDAENVASYDSKIKKIVHSIVSSFAFG → R 132-171: Missing. | ||||||
| Isoform 4 (identifier: Q6XPS3-4) Also known as: TPIP beta; The sequence of this isoform differs from the canonical sequence as follows: 40-170: Missing. 435-522: ILHDIETDKI...FAVEILFGEK → REEGSTLRRANWKGEPSRRPVLD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 522 | 522 | Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 | PRO_0000224187 | |||||
Regions | |||||||||
| Transmembrane | 66 – 86 | 21 | Helical; Potential | ||||||
| Transmembrane | 111 – 131 | 21 | Helical; Potential | ||||||
| Transmembrane | 146 – 166 | 21 | Helical; Potential | ||||||
| Domain | 210 – 386 | 177 | Phosphatase tensin-type | ||||||
| Domain | 393 – 522 | 130 | C2 tensin-type | ||||||
Sites | |||||||||
| Active site | 320 | 1 | Phosphocysteine intermediate Probable | ||||||
Natural variations | |||||||||
| Alternative sequence | 40 – 170 | 131 | Missing in isoform 4. | VSP_017322 | |||||
| Alternative sequence | 40 – 77 | 38 | SMLER…SFAFG → R in isoform 3. | VSP_017323 | |||||
| Alternative sequence | 132 – 171 | 40 | Missing in isoform 2 and isoform 3. | VSP_017324 | |||||
| Alternative sequence | 435 – 522 | 88 | ILHDI…LFGEK → REEGSTLRRANWKGEPSRRP VLD in isoform 4. | VSP_017325 | |||||
| Natural variant | 367 | 1 | V → I. Corresponds to variant rs2497218 [ dbSNP | Ensembl ]. | VAR_047501 | |||||
| Natural variant | 444 | 1 | I → V. Ref.2 Corresponds to variant rs2497218 [ dbSNP | Ensembl ]. | VAR_057349 | |||||
Experimental info | |||||||||
| Mutagenesis | 320 | 1 | C → S: Loss of activity. Ref.1 | ||||||
| Sequence conflict | 521 | 1 | E → K in CAD13144. Ref.1 | ||||||
| Sequence conflict | 521 | 1 | E → K in AAP45146. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ421032 mRNA. Translation: CAD13144.1. AJ421033 mRNA. Translation: CAD13145.1. AY219890 mRNA. Translation: AAP45146.1. AL590076 Genomic DNA. Translation: CAH73538.1. AL590076 Genomic DNA. Translation: CAH73539.1. CH471075 Genomic DNA. Translation: EAX08219.1. |
| IPI | IPI00418438. IPI00480172. IPI00719421. IPI01018832. |
| RefSeq | NP_001135440.1. NM_001141968.1. NP_570141.3. NM_130785.3. NP_954863.2. NM_199254.2. |
| UniGene | Hs.377488. |
3D structure databases | |
| ProteinModelPortal | Q6XPS3. |
| SMR | Q6XPS3. Positions 173-208, 210-521. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q6XPS3. |
PTM databases | |
| PhosphoSite | Q6XPS3. |
Polymorphism databases | |
| DMDM | 215273973. |
Proteomic databases | |
| PRIDE | Q6XPS3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000400230; ENSP00000383089; ENSG00000132958. |
| GeneID | 93492. |
| KEGG | hsa:93492. |
| UCSC | uc001umd.1. human. |
Organism-specific databases | |
| CTD | 93492. |
| GeneCards | GC13M019997. |
| H-InvDB | HIX0037315. |
| HGNC | HGNC:17299. TPTE2. |
| MIM | 606791. gene. |
| neXtProt | NX_Q6XPS3. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00550000074191. |
| HOGENOM | HBG745257. |
| HOVERGEN | HBG084209. |
| InParanoid | Q6XPS3. |
| PhylomeDB | Q6XPS3. |
Gene expression databases | |
| Bgee | Q6XPS3. |
| CleanEx | HS_TPTE2. |
| Genevestigator | Q6XPS3. |
Family and domain databases | |
| InterPro | IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR000340. Dual-sp_phosphatase_cat-dom. IPR005821. Ion_trans. IPR014019. Phosphatase_tensin-typ. IPR014020. Tensin_phosphatase_C2-dom. IPR016130. Tyr_Pase_AS. [Graphical view] |
| Pfam | PF00782. DSPc. 1 hit. PF00520. Ion_trans. 1 hit. PF10409. PTEN_C2. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. |
| PROSITE | PS51182. C2_TENSIN. 1 hit. PS51181. PPASE_TENSIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 78104. |
| SOURCE | Search... |
Entry information
| Entry name | TPTE2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6XPS3 Secondary accession number(s): B1AQ16 Q8WWL5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with