Reviewed,
UniProtKB/Swiss-Prot Q6XPS3 (TPTE2_HUMAN)
Last modified
January 19, 2010.
Version 59.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 EC=3.1.3.67 Alternative name(s): TPTE and PTEN homologous inositol lipid phosphatase Lipid phosphatase TPIP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 522 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | Phosphatidylinositol 3,4,5-trisphosphate + H2O = phosphatidylinositol 4,5-bisphosphate + phosphate. |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.1. |
| Tissue specificity | Isoform 3 is expressed in testis, brain and stomach while isoform 4 seems to be testis-specific. Ref.1 |
| Sequence similarities | Contains 1 C2 tensin-type domain. Contains 1 phosphatase tensin-type domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6XPS3-1) Also known as: TPIP gamma; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6XPS3-2) The sequence of this isoform differs from the canonical sequence as follows: 132-171: Missing. | ||||||
| Isoform 3 (identifier: Q6XPS3-3) Also known as: TPIP alpha; The sequence of this isoform differs from the canonical sequence as follows: 40-77: SMLERLSKFEVEDAENVASYDSKIKKIVHSIVSSFAFG → R 132-171: Missing. | ||||||
| Isoform 4 (identifier: Q6XPS3-4) Also known as: TPIP beta; The sequence of this isoform differs from the canonical sequence as follows: 40-170: Missing. 435-522: ILHDIETDKI...FAVEILFGEK → REEGSTLRRANWKGEPSRRPVLD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 522 | 522 | Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 | PRO_0000224187 | |||||
Regions | |||||||||
| Transmembrane | 66 – 86 | 21 | Potential | ||||||
| Transmembrane | 111 – 131 | 21 | Potential | ||||||
| Transmembrane | 146 – 166 | 21 | Potential | ||||||
| Domain | 210 – 386 | 177 | Phosphatase tensin-type | ||||||
| Domain | 393 – 522 | 130 | C2 tensin-type | ||||||
Sites | |||||||||
| Active site | 320 | 1 | Phosphocysteine intermediate Probable | ||||||
Natural variations | |||||||||
| Alternative sequence | 40 – 170 | 131 | Missing in isoform 4. | VSP_017322 | |||||
| Alternative sequence | 40 – 77 | 38 | SMLER…SFAFG → R in isoform 3. | VSP_017323 | |||||
| Alternative sequence | 132 – 171 | 40 | Missing in isoform 2 and isoform 3. | VSP_017324 | |||||
| Alternative sequence | 435 – 522 | 88 | ILHDI…LFGEK → REEGSTLRRANWKGEPSRRP VLD in isoform 4. | VSP_017325 | |||||
| Natural variant | 367 | 1 | V → I: dbSNP rs2497218. | VAR_047501 | |||||
| Natural variant | 444 | 1 | I → V: dbSNP rs2497218. Ref.2 | VAR_057349 | |||||
Experimental info | |||||||||
| Mutagenesis | 320 | 1 | C → S: Loss of activity. Ref.1 | ||||||
| Sequence conflict | 521 | 1 | E → K in CAD13144. Ref.1 | ||||||
| Sequence conflict | 521 | 1 | E → K in AAP45146. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ421032 mRNA. Translation: CAD13144.1. AJ421033 mRNA. Translation: CAD13145.1. AY219890 mRNA. Translation: AAP45146.1. AL590076 Genomic DNA. Translation: CAH73538.1. AL590076 Genomic DNA. Translation: CAH73539.1. CH471075 Genomic DNA. Translation: EAX08219.1. |
| IPI | IPI00418438. IPI00480172. IPI00719421. IPI00935789. |
| RefSeq | NP_001135440.1. NP_570141.3. NP_954863.2. |
| UniGene | Hs.377488 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q6XPS3. |
PTM databases | |
| PhosphoSite | Q6XPS3. |
Genome annotation databases | |
| Ensembl | ENST00000400230; ENSP00000383089; ENSG00000132958; Homo sapiens. [Genome view] |
| GeneID | 93492. |
| KEGG | hsa:93492. |
| UCSC | uc001umd.1. human. |
Organism-specific databases | |
| CTD | 93492. |
| GeneCards | GC13M018895. |
| H-InvDB | HIX0020751. HIX0022787. HIX0037315. HIX0037502. HIX0080243. |
| HGNC | HGNC:17299. TPTE2. |
| MIM | 606791. gene. |
| PharmGKB | PA134917664. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | HBG745257. |
| HOVERGEN | Q6XPS3. |
| InParanoid | Q6XPS3. |
Enzyme and pathway databases | |
| BRENDA | 3.1.3.67. 247. |
Gene expression databases | |
| Bgee | Q6XPS3. |
| CleanEx | HS_TPTE2. |
| Genevestigator | Q6XPS3. |
Family and domain databases | |
| InterPro | IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR000340. Dual-sp_phosphatase_cat-dom. IPR005821. Ion_trans. IPR014019. Phosphatase_tensin-typ. IPR014020. Tensin_phosphatase_C2-dom. IPR016130. Tyr_Pase_AS. [Graphical view] |
| Pfam | PF00782. DSPc. 1 hit. PF00520. Ion_trans. 1 hit. PF10409. PTEN_C2. 1 hit. [Graphical view] |
| PROSITE | PS51182. C2_TENSIN. 1 hit. PS51181. PPASE_TENSIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 78104. |
| SOURCE | Search... |
Entry information
| Entry name | TPTE2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6XPS3 Secondary accession number(s): B1AQ16 Q8WWL5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


