Reviewed,
UniProtKB/Swiss-Prot Q6XPS3 (TPTE2_HUMAN)
Last modified
May 26, 2009.
Version 51.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 EC=3.1.3.67 Alternative name(s): TPTE and PTEN homologous inositol lipid phosphatase Lipid phosphatase TPIP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 522 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | Phosphatidylinositol 3,4,5-trisphosphate + H2O = phosphatidylinositol 4,5-bisphosphate + phosphate. |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Ref.1 |
| Tissue specificity | Isoform 3 is expressed in testis, brain and stomach while isoform 4 seems to be testis-specific. Ref.1 |
| Sequence similarities | Contains 1 C2 tensin-type domain. Contains 1 phosphatase tensin-type domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane |
| Molecular function | Hydrolase |
| Gene Ontology (GO) | |
| Cellular component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6XPS3-1) Also known as: TPIP gamma; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6XPS3-2) The sequence of this isoform differs from the canonical sequence as follows: 132-171: Missing. | ||||||
| Isoform 3 (identifier: Q6XPS3-3) Also known as: TPIP alpha; The sequence of this isoform differs from the canonical sequence as follows: 40-77: SMLERLSKFEVEDAENVASYDSKIKKIVHSIVSSFAFG → R 132-171: Missing. | ||||||
| Isoform 4 (identifier: Q6XPS3-4) Also known as: TPIP beta; The sequence of this isoform differs from the canonical sequence as follows: 40-170: Missing. 435-522: ILHDIETDKI...FAVEILFGEK → REEGSTLRRANWKGEPSRRPVLD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 522 | 522 | Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 | PRO_0000224187 | |||||
Regions | |||||||||
| Transmembrane | 66 – 86 | 21 | Potential | ||||||
| Transmembrane | 111 – 131 | 21 | Potential | ||||||
| Transmembrane | 146 – 166 | 21 | Potential | ||||||
| Domain | 210 – 386 | 177 | Phosphatase tensin-type | ||||||
| Domain | 393 – 522 | 130 | C2 tensin-type | ||||||
Sites | |||||||||
| Active site | 320 | 1 | Phosphocysteine intermediate Probable | ||||||
Natural variations | |||||||||
| Alternative sequence | 40 – 170 | 131 | Missing in isoform 4. | VSP_017322 | |||||
| Alternative sequence | 40 – 77 | 38 | SMLER…SFAFG → R in isoform 3. | VSP_017323 | |||||
| Alternative sequence | 132 – 171 | 40 | Missing in isoform 2 and isoform 3. | VSP_017324 | |||||
| Alternative sequence | 435 – 522 | 88 | ILHDI…LFGEK → REEGSTLRRANWKGEPSRRP VLD in isoform 4. | VSP_017325 | |||||
| Natural variant | 367 | 1 | V → I: dbSNP rs2497218. | VAR_047501 | |||||
| Natural variant | 444 | 1 | I → V: dbSNP rs2497218. | VAR_057349 | |||||
Experimental info | |||||||||
| Mutagenesis | 320 | 1 | C → S: Loss of activity. Ref.1 | ||||||
| Sequence conflict | 521 | 1 | E → K in CAD13144. Ref.1 | ||||||
| Sequence conflict | 521 | 1 | E → K in AAP45146. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "TPIP: a novel phosphoinositide 3-phosphatase." Walker S.M., Downes C.P., Leslie N.R. Biochem. J. 360:277-283(2001) [PubMed: 11716755] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, MUTAGENESIS OF CYS-320. Tissue: Testis. |
| [2] | "The TPTE gene family: cellular expression, subcellular localization and alternative splicing." Tapparel C., Reymond A., Girardet C., Guillou L., Lyle R., Lamon C., Hutter P., Antonarakis S.E. Gene 323:189-199(2003) [PubMed: 14659893] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT VAL-444. |
| [3] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed: 15057823] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
Cross-references
Sequence databases | |
|---|---|
| AJ421032 mRNA. Translation: CAD13144.1. AJ421033 mRNA. Translation: CAD13145.1. AY219890 mRNA. Translation: AAP45146.1. AL590076 Genomic DNA. Translation: CAH73539.1. | |
| IPI | IPI00103364. IPI00418438. IPI00480172. IPI00719421. |
| RefSeq | NP_001135440.1. NP_570141.3. NP_954863.2. |
| UniGene | Hs.377488 |
3D structure databases | |
| ModBase | Search... |
Genome annotation databases | |
| Ensembl | ENSG00000132958. Homo sapiens. [Contig view] |
| GeneID | 93492. |
Organism-specific databases | |
| GeneCards | GC13M018895. |
| H-InvDB | HIX0020751. HIX0022787. HIX0037315. HIX0037502. HIX0080243. |
| HGNC | HGNC:17299. TPTE2. |
| MIM | 606791. gene. |
| PharmGKB | PA134917664. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q6XPS3. |
| HOVERGEN | Q6XPS3. |
Enzyme and pathway databases | |
| BRENDA | 3.1.3.67. 247. |
Gene expression databases | |
| Bgee | Q6XPS3. |
| CleanEx | HS_TPTE2. |
Family and domain databases | |
| InterPro | IPR014019. Phosphatase_tensin-typ. IPR014020. Tensin_phosphatase_C2-dom. [Graphical view] |
| Pfam | PF10409. PTEN_C2. 1 hit. [Graphical view] |
| PROSITE | PS51182. C2_TENSIN. 1 hit. PS51181. PPASE_TENSIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 78104. |
| SOURCE | Search... |
Entry information
| Entry name | TPTE2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6XPS3 Secondary accession number(s): Q5VUH2, Q8WWL4, Q8WWL5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


