Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Choline transporter-like protein 1

Gene

Slc44a1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Choline transporter. May be involved in membrane synthesis and myelin production.2 Publications

GO - Molecular functioni

  • choline transmembrane transporter activity Source: MGI

GO - Biological processi

  • choline transport Source: MGI
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiR-MMU-1483191. Synthesis of PC.
R-MMU-425366. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.
R-MMU-6798163. Choline catabolism.

Protein family/group databases

TCDBi2.A.92.1.1. the choline transporter-like (ctl) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Choline transporter-like protein 1
Alternative name(s):
Solute carrier family 44 member 1
CD_antigen: CD92
Gene namesi
Name:Slc44a1
Synonyms:Cd92, Cdw92, Ctl1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:2140592. Slc44a1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini2 – 29CytoplasmicSequence analysisAdd BLAST28
Transmembranei30 – 50HelicalSequence analysisAdd BLAST21
Topological domaini51 – 211Mitochondrial intermembraneSequence analysisAdd BLAST161
Transmembranei212 – 232HelicalSequence analysisAdd BLAST21
Topological domaini233 – 237CytoplasmicSequence analysis5
Transmembranei238 – 258HelicalSequence analysisAdd BLAST21
Topological domaini259 – 287Mitochondrial intermembraneSequence analysisAdd BLAST29
Transmembranei288 – 308HelicalSequence analysisAdd BLAST21
Topological domaini309 – 314CytoplasmicSequence analysis6
Transmembranei315 – 335HelicalSequence analysisAdd BLAST21
Topological domaini336 – 337Mitochondrial intermembraneSequence analysis2
Transmembranei338 – 358HelicalSequence analysisAdd BLAST21
Topological domaini359 – 379CytoplasmicSequence analysisAdd BLAST21
Transmembranei380 – 400HelicalSequence analysisAdd BLAST21
Topological domaini401 – 536Mitochondrial intermembraneSequence analysisAdd BLAST136
Transmembranei537 – 557HelicalSequence analysisAdd BLAST21
Topological domaini558 – 565CytoplasmicSequence analysis8
Transmembranei566 – 586HelicalSequence analysisAdd BLAST21
Topological domaini587 – 653Mitochondrial intermembraneSequence analysisAdd BLAST67

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Mitochondrion, Mitochondrion outer membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00001917132 – 653Choline transporter-like protein 1Add BLAST652

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycineBy similarity1

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

PaxDbiQ6X893.
PRIDEiQ6X893.

PTM databases

PhosphoSitePlusiQ6X893.
SwissPalmiQ6X893.

Expressioni

Tissue specificityi

Specifically abundant in skeletal muscle (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000028412.
CleanExiMM_SLC44A1.
ExpressionAtlasiQ6X893. baseline and differential.
GenevisibleiQ6X893. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000099975.

Structurei

3D structure databases

ProteinModelPortaliQ6X893.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi473 – 491Cys-richAdd BLAST19

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1362. Eukaryota.
ENOG410XS0P. LUCA.
GeneTreeiENSGT00550000074521.
HOGENOMiHOG000231655.
HOVERGENiHBG080361.
InParanoidiQ6X893.
KOiK06515.
TreeFamiTF313325.

Family and domain databases

InterProiIPR007603. Choline_transptr-like.
[Graphical view]
PANTHERiPTHR12385. PTHR12385. 1 hit.
PfamiPF04515. Choline_transpo. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6X893-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCCSSASAA QSSKREWKPL EDRSCTDIPW LLLFVLFCIG MGFICGFSVA
60 70 80 90 100
TGAAARLVSG YDSYGNICGQ RNAKLEAIPN SGLDHTHRKY VFFLDPCNLD
110 120 130 140 150
LINRKIKSIA LCVAACPRQE LKTLSDVQKF AEINGSALCS YNIKPSEYTL
160 170 180 190 200
TSKSSGFCPK LPVPASAPIP FFHRCAPVNI SCYAKFAEAL ITFVSDNSVL
210 220 230 240 250
HRLISGVMTS KEIILGLCLL SLVLSMILMV IIRYISRVLV WILTVLVILG
260 270 280 290 300
SLGGTGVLWW LYAKQRRSPK EAVIPEQLQI AEDNLRALLI YAISATVFTV
310 320 330 340 350
ILFLIMLVMR KRVALTIALF HVAGKVFIHL PLLVFQPFWT FFALVLFWAY
360 370 380 390 400
WIMTLLFLGT TGSAVQNEQG FVEYKISGPL QYMWWYHVVG LIWISEFILA
410 420 430 440 450
CQQMTVAGAV VTYYFTRDKR NLPFTPILAS VNRLIRYHLG TVAKGSFIIT
460 470 480 490 500
LVKIPRMVLM YIHSQLKGKE NACARCMLKS CICCLWCLEK CLSYLNQNAY
510 520 530 540 550
TATAINSTNF CTSAKDAFVI LVENALRVAA INTVGDFMLF LGKVLIVCST
560 570 580 590 600
GLAGIMLLNY QQDYTVWVLP LIIVCLFAFL VAHCFLSIYE MVVDVLFLCF
610 620 630 640 650
AIDTKYNDGS PGREFYMDKV LMEFVENSRK AMKEAGKGGA ADARELKPML

RKR
Length:653
Mass (Da):73,067
Last modified:July 27, 2011 - v3
Checksum:i639979730CFE5913
GO
Isoform 2 (identifier: Q6X893-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     650-653: LRKR → VGSEEEAAALHDFPFHFFSVCVFTDCTSSGEALVVCITQDMLLFLFACLPITWMAEVLSQLRLPSVKVS

Show »
Length:718
Mass (Da):80,094
Checksum:iBE6B6397D3E09F33
GO

Sequence cautioni

The sequence AAH25941 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti426P → L in AAP81042 (PubMed:15474312).Curated1
Sequence conflicti426P → L in AAP81043 (PubMed:15474312).Curated1
Sequence conflicti439L → F in AAP81042 (PubMed:15474312).Curated1
Sequence conflicti439L → F in AAP81043 (PubMed:15474312).Curated1
Sequence conflicti510F → L in AAP81042 (PubMed:15474312).Curated1
Sequence conflicti510F → L in AAP81043 (PubMed:15474312).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015428650 – 653LRKR → VGSEEEAAALHDFPFHFFSV CVFTDCTSSGEALVVCITQD MLLFLFACLPITWMAEVLSQ LRLPSVKVS in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY249865 mRNA. Translation: AAP81042.1.
AY249866 mRNA. Translation: AAP81043.1.
AL807745, AL805900 Genomic DNA. Translation: CAM17555.1.
AL805900, AL807745 Genomic DNA. Translation: CAM27148.1.
BC010258 mRNA. Translation: AAH10258.1.
BC025941 mRNA. Translation: AAH25941.1. Different initiation.
BC113167 mRNA. Translation: AAI13168.1.
BC113169 mRNA. Translation: AAI13170.1.
CCDSiCCDS18189.1. [Q6X893-1]
RefSeqiNP_598652.3. NM_133891.3. [Q6X893-1]
UniGeneiMm.482207.
Mm.491170.

Genome annotation databases

EnsembliENSMUST00000102911; ENSMUSP00000099975; ENSMUSG00000028412. [Q6X893-1]
GeneIDi100434.
KEGGimmu:100434.
UCSCiuc008swz.2. mouse. [Q6X893-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY249865 mRNA. Translation: AAP81042.1.
AY249866 mRNA. Translation: AAP81043.1.
AL807745, AL805900 Genomic DNA. Translation: CAM17555.1.
AL805900, AL807745 Genomic DNA. Translation: CAM27148.1.
BC010258 mRNA. Translation: AAH10258.1.
BC025941 mRNA. Translation: AAH25941.1. Different initiation.
BC113167 mRNA. Translation: AAI13168.1.
BC113169 mRNA. Translation: AAI13170.1.
CCDSiCCDS18189.1. [Q6X893-1]
RefSeqiNP_598652.3. NM_133891.3. [Q6X893-1]
UniGeneiMm.482207.
Mm.491170.

3D structure databases

ProteinModelPortaliQ6X893.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000099975.

Protein family/group databases

TCDBi2.A.92.1.1. the choline transporter-like (ctl) family.

PTM databases

PhosphoSitePlusiQ6X893.
SwissPalmiQ6X893.

Proteomic databases

PaxDbiQ6X893.
PRIDEiQ6X893.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000102911; ENSMUSP00000099975; ENSMUSG00000028412. [Q6X893-1]
GeneIDi100434.
KEGGimmu:100434.
UCSCiuc008swz.2. mouse. [Q6X893-1]

Organism-specific databases

CTDi23446.
MGIiMGI:2140592. Slc44a1.

Phylogenomic databases

eggNOGiKOG1362. Eukaryota.
ENOG410XS0P. LUCA.
GeneTreeiENSGT00550000074521.
HOGENOMiHOG000231655.
HOVERGENiHBG080361.
InParanoidiQ6X893.
KOiK06515.
TreeFamiTF313325.

Enzyme and pathway databases

ReactomeiR-MMU-1483191. Synthesis of PC.
R-MMU-425366. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.
R-MMU-6798163. Choline catabolism.

Miscellaneous databases

ChiTaRSiSlc44a1. mouse.
PROiQ6X893.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028412.
CleanExiMM_SLC44A1.
ExpressionAtlasiQ6X893. baseline and differential.
GenevisibleiQ6X893. MM.

Family and domain databases

InterProiIPR007603. Choline_transptr-like.
[Graphical view]
PANTHERiPTHR12385. PTHR12385. 1 hit.
PfamiPF04515. Choline_transpo. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCTL1_MOUSE
AccessioniPrimary (citable) accession number: Q6X893
Secondary accession number(s): Q14DK0
, Q6X894, Q8R0Y4, Q91Z29
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: July 27, 2011
Last modified: November 2, 2016
This is version 100 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.