Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6X893

- CTL1_MOUSE

UniProt

Q6X893 - CTL1_MOUSE

Protein

Choline transporter-like protein 1

Gene

Slc44a1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 82 (01 Oct 2014)
      Sequence version 3 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Choline transporter. May be involved in membrane synthesis and myelin production.2 Publications

    GO - Molecular functioni

    1. choline transmembrane transporter activity Source: MGI

    GO - Biological processi

    1. choline transport Source: MGI

    Keywords - Biological processi

    Transport

    Enzyme and pathway databases

    ReactomeiREACT_207335. Synthesis of PC.
    REACT_217615. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

    Protein family/group databases

    TCDBi2.A.92.1.1. the choline transporter-like (ctl) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Choline transporter-like protein 1
    Alternative name(s):
    Solute carrier family 44 member 1
    CD_antigen: CD92
    Gene namesi
    Name:Slc44a1
    Synonyms:Cd92, Cdw92, Ctl1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 4

    Organism-specific databases

    MGIiMGI:2140592. Slc44a1.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: MGI
    2. mitochondrial outer membrane Source: UniProtKB-SubCell
    3. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane, Mitochondrion, Mitochondrion outer membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 653652Choline transporter-like protein 1PRO_0000191713Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi2 – 21N-myristoyl glycineBy similarity

    Keywords - PTMi

    Lipoprotein, Myristate

    Proteomic databases

    MaxQBiQ6X893.
    PaxDbiQ6X893.
    PRIDEiQ6X893.

    PTM databases

    PhosphoSiteiQ6X893.

    Expressioni

    Tissue specificityi

    Specifically abundant in skeletal muscle (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiQ6X893.
    BgeeiQ6X893.
    CleanExiMM_SLC44A1.
    GenevestigatoriQ6X893.

    Interactioni

    Protein-protein interaction databases

    STRINGi10090.ENSMUSP00000103274.

    Structurei

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini2 – 2928CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini51 – 211161Mitochondrial intermembraneSequence AnalysisAdd
    BLAST
    Topological domaini233 – 2375CytoplasmicSequence Analysis
    Topological domaini259 – 28729Mitochondrial intermembraneSequence AnalysisAdd
    BLAST
    Topological domaini309 – 3146CytoplasmicSequence Analysis
    Topological domaini336 – 3372Mitochondrial intermembraneSequence Analysis
    Topological domaini359 – 37921CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini401 – 536136Mitochondrial intermembraneSequence AnalysisAdd
    BLAST
    Topological domaini558 – 5658CytoplasmicSequence Analysis
    Topological domaini587 – 65367Mitochondrial intermembraneSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei30 – 5021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei212 – 23221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei238 – 25821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei288 – 30821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei315 – 33521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei338 – 35821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei380 – 40021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei537 – 55721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei566 – 58621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi473 – 49119Cys-richAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG310633.
    GeneTreeiENSGT00550000074521.
    HOGENOMiHOG000231655.
    HOVERGENiHBG080361.
    KOiK06515.
    OrthoDBiEOG72JWFP.
    TreeFamiTF313325.

    Family and domain databases

    InterProiIPR007603. Choline_transptr-like.
    [Graphical view]
    PANTHERiPTHR12385. PTHR12385. 1 hit.
    PfamiPF04515. Choline_transpo. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6X893-1) [UniParc]FASTAAdd to Basket

    Also known as: A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGCCSSASAA QSSKREWKPL EDRSCTDIPW LLLFVLFCIG MGFICGFSVA    50
    TGAAARLVSG YDSYGNICGQ RNAKLEAIPN SGLDHTHRKY VFFLDPCNLD 100
    LINRKIKSIA LCVAACPRQE LKTLSDVQKF AEINGSALCS YNIKPSEYTL 150
    TSKSSGFCPK LPVPASAPIP FFHRCAPVNI SCYAKFAEAL ITFVSDNSVL 200
    HRLISGVMTS KEIILGLCLL SLVLSMILMV IIRYISRVLV WILTVLVILG 250
    SLGGTGVLWW LYAKQRRSPK EAVIPEQLQI AEDNLRALLI YAISATVFTV 300
    ILFLIMLVMR KRVALTIALF HVAGKVFIHL PLLVFQPFWT FFALVLFWAY 350
    WIMTLLFLGT TGSAVQNEQG FVEYKISGPL QYMWWYHVVG LIWISEFILA 400
    CQQMTVAGAV VTYYFTRDKR NLPFTPILAS VNRLIRYHLG TVAKGSFIIT 450
    LVKIPRMVLM YIHSQLKGKE NACARCMLKS CICCLWCLEK CLSYLNQNAY 500
    TATAINSTNF CTSAKDAFVI LVENALRVAA INTVGDFMLF LGKVLIVCST 550
    GLAGIMLLNY QQDYTVWVLP LIIVCLFAFL VAHCFLSIYE MVVDVLFLCF 600
    AIDTKYNDGS PGREFYMDKV LMEFVENSRK AMKEAGKGGA ADARELKPML 650
    RKR 653
    Length:653
    Mass (Da):73,067
    Last modified:July 27, 2011 - v3
    Checksum:i639979730CFE5913
    GO
    Isoform 2 (identifier: Q6X893-2) [UniParc]FASTAAdd to Basket

    Also known as: B

    The sequence of this isoform differs from the canonical sequence as follows:
         650-653: LRKR → VGSEEEAAALHDFPFHFFSVCVFTDCTSSGEALVVCITQDMLLFLFACLPITWMAEVLSQLRLPSVKVS

    Show »
    Length:718
    Mass (Da):80,094
    Checksum:iBE6B6397D3E09F33
    GO

    Sequence cautioni

    The sequence AAH25941.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti426 – 4261P → L in AAP81042. (PubMed:15474312)Curated
    Sequence conflicti426 – 4261P → L in AAP81043. (PubMed:15474312)Curated
    Sequence conflicti439 – 4391L → F in AAP81042. (PubMed:15474312)Curated
    Sequence conflicti439 – 4391L → F in AAP81043. (PubMed:15474312)Curated
    Sequence conflicti510 – 5101F → L in AAP81042. (PubMed:15474312)Curated
    Sequence conflicti510 – 5101F → L in AAP81043. (PubMed:15474312)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei650 – 6534LRKR → VGSEEEAAALHDFPFHFFSV CVFTDCTSSGEALVVCITQD MLLFLFACLPITWMAEVLSQ LRLPSVKVS in isoform 2. 1 PublicationVSP_015428

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY249865 mRNA. Translation: AAP81042.1.
    AY249866 mRNA. Translation: AAP81043.1.
    AL807745, AL805900 Genomic DNA. Translation: CAM17555.1.
    AL805900, AL807745 Genomic DNA. Translation: CAM27148.1.
    BC010258 mRNA. Translation: AAH10258.1.
    BC025941 mRNA. Translation: AAH25941.1. Different initiation.
    BC113167 mRNA. Translation: AAI13168.1.
    BC113169 mRNA. Translation: AAI13170.1.
    CCDSiCCDS18189.1. [Q6X893-1]
    RefSeqiNP_598652.3. NM_133891.3. [Q6X893-1]
    UniGeneiMm.482207.
    Mm.491170.

    Genome annotation databases

    EnsembliENSMUST00000102911; ENSMUSP00000099975; ENSMUSG00000028412. [Q6X893-1]
    GeneIDi100434.
    KEGGimmu:100434.
    UCSCiuc008swz.2. mouse. [Q6X893-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY249865 mRNA. Translation: AAP81042.1 .
    AY249866 mRNA. Translation: AAP81043.1 .
    AL807745 , AL805900 Genomic DNA. Translation: CAM17555.1 .
    AL805900 , AL807745 Genomic DNA. Translation: CAM27148.1 .
    BC010258 mRNA. Translation: AAH10258.1 .
    BC025941 mRNA. Translation: AAH25941.1 . Different initiation.
    BC113167 mRNA. Translation: AAI13168.1 .
    BC113169 mRNA. Translation: AAI13170.1 .
    CCDSi CCDS18189.1. [Q6X893-1 ]
    RefSeqi NP_598652.3. NM_133891.3. [Q6X893-1 ]
    UniGenei Mm.482207.
    Mm.491170.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10090.ENSMUSP00000103274.

    Protein family/group databases

    TCDBi 2.A.92.1.1. the choline transporter-like (ctl) family.

    PTM databases

    PhosphoSitei Q6X893.

    Proteomic databases

    MaxQBi Q6X893.
    PaxDbi Q6X893.
    PRIDEi Q6X893.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000102911 ; ENSMUSP00000099975 ; ENSMUSG00000028412 . [Q6X893-1 ]
    GeneIDi 100434.
    KEGGi mmu:100434.
    UCSCi uc008swz.2. mouse. [Q6X893-1 ]

    Organism-specific databases

    CTDi 23446.
    MGIi MGI:2140592. Slc44a1.

    Phylogenomic databases

    eggNOGi NOG310633.
    GeneTreei ENSGT00550000074521.
    HOGENOMi HOG000231655.
    HOVERGENi HBG080361.
    KOi K06515.
    OrthoDBi EOG72JWFP.
    TreeFami TF313325.

    Enzyme and pathway databases

    Reactomei REACT_207335. Synthesis of PC.
    REACT_217615. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

    Miscellaneous databases

    NextBioi 354424.
    PROi Q6X893.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6X893.
    Bgeei Q6X893.
    CleanExi MM_SLC44A1.
    Genevestigatori Q6X893.

    Family and domain databases

    InterProi IPR007603. Choline_transptr-like.
    [Graphical view ]
    PANTHERi PTHR12385. PTHR12385. 1 hit.
    Pfami PF04515. Choline_transpo. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and expression of a mouse muscle-specific CTL1 gene."
      Yuan Z., Wagner L., Poloumienko A., Bakovic M.
      Gene 341:305-312(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, FUNCTION.
      Tissue: Fibroblast.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: FVB/N.
      Tissue: Liver and Mammary gland.
    4. "The solute carrier 44A1 is a mitochondrial protein and mediates choline transport."
      Michel V., Bakovic M.
      FASEB J. 23:2749-2758(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TOPOLOGY, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiCTL1_MOUSE
    AccessioniPrimary (citable) accession number: Q6X893
    Secondary accession number(s): Q14DK0
    , Q6X894, Q8R0Y4, Q91Z29
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 30, 2005
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 82 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3