Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6X893 (CTL1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 80. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Choline transporter-like protein 1
Alternative name(s):
Solute carrier family 44 member 1
CD_antigen=CD92
Gene names
Name:Slc44a1
Synonyms:Cd92, Cdw92, Ctl1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length653 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Choline transporter. May be involved in membrane synthesis and myelin production. Ref.1 Ref.4

Subcellular location

Cell membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein Ref.1 Ref.4.

Tissue specificity

Specifically abundant in skeletal muscle (at protein level). Ref.1

Sequence similarities

Belongs to the CTL (choline transporter-like) family.

Sequence caution

The sequence AAH25941.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6X893-1)

Also known as: A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6X893-2)

Also known as: B;

The sequence of this isoform differs from the canonical sequence as follows:
     650-653: LRKR → VGSEEEAAALHDFPFHFFSVCVFTDCTSSGEALVVCITQDMLLFLFACLPITWMAEVLSQLRLPSVKVS

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed By similarity
Chain2 – 653652Choline transporter-like protein 1
PRO_0000191713

Regions

Topological domain2 – 2928Cytoplasmic Potential
Transmembrane30 – 5021Helical; Potential
Topological domain51 – 211161Mitochondrial intermembrane Potential
Transmembrane212 – 23221Helical; Potential
Topological domain233 – 2375Cytoplasmic Potential
Transmembrane238 – 25821Helical; Potential
Topological domain259 – 28729Mitochondrial intermembrane Potential
Transmembrane288 – 30821Helical; Potential
Topological domain309 – 3146Cytoplasmic Potential
Transmembrane315 – 33521Helical; Potential
Topological domain336 – 3372Mitochondrial intermembrane Potential
Transmembrane338 – 35821Helical; Potential
Topological domain359 – 37921Cytoplasmic Potential
Transmembrane380 – 40021Helical; Potential
Topological domain401 – 536136Mitochondrial intermembrane Potential
Transmembrane537 – 55721Helical; Potential
Topological domain558 – 5658Cytoplasmic Potential
Transmembrane566 – 58621Helical; Potential
Topological domain587 – 65367Mitochondrial intermembrane Potential
Compositional bias473 – 49119Cys-rich

Amino acid modifications

Lipidation21N-myristoyl glycine By similarity

Natural variations

Alternative sequence650 – 6534LRKR → VGSEEEAAALHDFPFHFFSV CVFTDCTSSGEALVVCITQD MLLFLFACLPITWMAEVLSQ LRLPSVKVS in isoform 2.
VSP_015428

Experimental info

Sequence conflict4261P → L in AAP81042. Ref.1
Sequence conflict4261P → L in AAP81043. Ref.1
Sequence conflict4391L → F in AAP81042. Ref.1
Sequence conflict4391L → F in AAP81043. Ref.1
Sequence conflict5101F → L in AAP81042. Ref.1
Sequence conflict5101F → L in AAP81043. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (A) [UniParc].

Last modified July 27, 2011. Version 3.
Checksum: 639979730CFE5913

FASTA65373,067
        10         20         30         40         50         60 
MGCCSSASAA QSSKREWKPL EDRSCTDIPW LLLFVLFCIG MGFICGFSVA TGAAARLVSG 

        70         80         90        100        110        120 
YDSYGNICGQ RNAKLEAIPN SGLDHTHRKY VFFLDPCNLD LINRKIKSIA LCVAACPRQE 

       130        140        150        160        170        180 
LKTLSDVQKF AEINGSALCS YNIKPSEYTL TSKSSGFCPK LPVPASAPIP FFHRCAPVNI 

       190        200        210        220        230        240 
SCYAKFAEAL ITFVSDNSVL HRLISGVMTS KEIILGLCLL SLVLSMILMV IIRYISRVLV 

       250        260        270        280        290        300 
WILTVLVILG SLGGTGVLWW LYAKQRRSPK EAVIPEQLQI AEDNLRALLI YAISATVFTV 

       310        320        330        340        350        360 
ILFLIMLVMR KRVALTIALF HVAGKVFIHL PLLVFQPFWT FFALVLFWAY WIMTLLFLGT 

       370        380        390        400        410        420 
TGSAVQNEQG FVEYKISGPL QYMWWYHVVG LIWISEFILA CQQMTVAGAV VTYYFTRDKR 

       430        440        450        460        470        480 
NLPFTPILAS VNRLIRYHLG TVAKGSFIIT LVKIPRMVLM YIHSQLKGKE NACARCMLKS 

       490        500        510        520        530        540 
CICCLWCLEK CLSYLNQNAY TATAINSTNF CTSAKDAFVI LVENALRVAA INTVGDFMLF 

       550        560        570        580        590        600 
LGKVLIVCST GLAGIMLLNY QQDYTVWVLP LIIVCLFAFL VAHCFLSIYE MVVDVLFLCF 

       610        620        630        640        650 
AIDTKYNDGS PGREFYMDKV LMEFVENSRK AMKEAGKGGA ADARELKPML RKR 

« Hide

Isoform 2 (B) [UniParc].

Checksum: BE6B6397D3E09F33
Show »

FASTA71880,094

References

« Hide 'large scale' references
[1]"Identification and expression of a mouse muscle-specific CTL1 gene."
Yuan Z., Wagner L., Poloumienko A., Bakovic M.
Gene 341:305-312(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, FUNCTION.
Tissue: Fibroblast.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: FVB/N.
Tissue: Liver and Mammary gland.
[4]"The solute carrier 44A1 is a mitochondrial protein and mediates choline transport."
Michel V., Bakovic M.
FASEB J. 23:2749-2758(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TOPOLOGY, SUBCELLULAR LOCATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY249865 mRNA. Translation: AAP81042.1.
AY249866 mRNA. Translation: AAP81043.1.
AL807745, AL805900 Genomic DNA. Translation: CAM17555.1.
AL805900, AL807745 Genomic DNA. Translation: CAM27148.1.
BC010258 mRNA. Translation: AAH10258.1.
BC025941 mRNA. Translation: AAH25941.1. Different initiation.
BC113167 mRNA. Translation: AAI13168.1.
BC113169 mRNA. Translation: AAI13170.1.
CCDSCCDS18189.1. [Q6X893-1]
RefSeqNP_598652.3. NM_133891.3. [Q6X893-1]
UniGeneMm.482207.
Mm.491170.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING10090.ENSMUSP00000103274.

Protein family/group databases

TCDB2.A.92.1.1. the choline transporter-like (ctl) family.

PTM databases

PhosphoSiteQ6X893.

Proteomic databases

MaxQBQ6X893.
PaxDbQ6X893.
PRIDEQ6X893.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000102911; ENSMUSP00000099975; ENSMUSG00000028412. [Q6X893-1]
GeneID100434.
KEGGmmu:100434.
UCSCuc008swz.2. mouse. [Q6X893-1]

Organism-specific databases

CTD23446.
MGIMGI:2140592. Slc44a1.

Phylogenomic databases

eggNOGNOG310633.
GeneTreeENSGT00550000074521.
HOGENOMHOG000231655.
HOVERGENHBG080361.
KOK06515.
OrthoDBEOG72JWFP.
TreeFamTF313325.

Gene expression databases

ArrayExpressQ6X893.
BgeeQ6X893.
CleanExMM_SLC44A1.
GenevestigatorQ6X893.

Family and domain databases

InterProIPR007603. Choline_transptr-like.
[Graphical view]
PANTHERPTHR12385. PTHR12385. 1 hit.
PfamPF04515. Choline_transpo. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio354424.
PROQ6X893.
SOURCESearch...

Entry information

Entry nameCTL1_MOUSE
AccessionPrimary (citable) accession number: Q6X893
Secondary accession number(s): Q14DK0 expand/collapse secondary AC list , Q6X894, Q8R0Y4, Q91Z29
Entry history
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: July 27, 2011
Last modified: July 9, 2014
This is version 80 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot