Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6X893

- CTL1_MOUSE

UniProt

Q6X893 - CTL1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Choline transporter-like protein 1

Gene

Slc44a1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Choline transporter. May be involved in membrane synthesis and myelin production.2 Publications

GO - Molecular functioni

  1. choline transmembrane transporter activity Source: MGI

GO - Biological processi

  1. choline transport Source: MGI
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_207335. Synthesis of PC.
REACT_217615. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Protein family/group databases

TCDBi2.A.92.1.1. the choline transporter-like (ctl) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Choline transporter-like protein 1
Alternative name(s):
Solute carrier family 44 member 1
CD_antigen: CD92
Gene namesi
Name:Slc44a1
Synonyms:Cd92, Cdw92, Ctl1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 4

Organism-specific databases

MGIiMGI:2140592. Slc44a1.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: Ensembl
  2. integral component of membrane Source: MGI
  3. mitochondrial outer membrane Source: UniProtKB-KW
  4. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Mitochondrion, Mitochondrion outer membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 653652Choline transporter-like protein 1PRO_0000191713Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi2 – 21N-myristoyl glycineBy similarity

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

MaxQBiQ6X893.
PaxDbiQ6X893.
PRIDEiQ6X893.

PTM databases

PhosphoSiteiQ6X893.

Expressioni

Tissue specificityi

Specifically abundant in skeletal muscle (at protein level).1 Publication

Gene expression databases

BgeeiQ6X893.
CleanExiMM_SLC44A1.
ExpressionAtlasiQ6X893. baseline and differential.
GenevestigatoriQ6X893.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000103274.

Structurei

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini2 – 2928CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini51 – 211161Mitochondrial intermembraneSequence AnalysisAdd
BLAST
Topological domaini233 – 2375CytoplasmicSequence Analysis
Topological domaini259 – 28729Mitochondrial intermembraneSequence AnalysisAdd
BLAST
Topological domaini309 – 3146CytoplasmicSequence Analysis
Topological domaini336 – 3372Mitochondrial intermembraneSequence Analysis
Topological domaini359 – 37921CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini401 – 536136Mitochondrial intermembraneSequence AnalysisAdd
BLAST
Topological domaini558 – 5658CytoplasmicSequence Analysis
Topological domaini587 – 65367Mitochondrial intermembraneSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei30 – 5021HelicalSequence AnalysisAdd
BLAST
Transmembranei212 – 23221HelicalSequence AnalysisAdd
BLAST
Transmembranei238 – 25821HelicalSequence AnalysisAdd
BLAST
Transmembranei288 – 30821HelicalSequence AnalysisAdd
BLAST
Transmembranei315 – 33521HelicalSequence AnalysisAdd
BLAST
Transmembranei338 – 35821HelicalSequence AnalysisAdd
BLAST
Transmembranei380 – 40021HelicalSequence AnalysisAdd
BLAST
Transmembranei537 – 55721HelicalSequence AnalysisAdd
BLAST
Transmembranei566 – 58621HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi473 – 49119Cys-richAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG310633.
GeneTreeiENSGT00550000074521.
HOGENOMiHOG000231655.
HOVERGENiHBG080361.
InParanoidiQ6X893.
KOiK06515.
OrthoDBiEOG72JWFP.
TreeFamiTF313325.

Family and domain databases

InterProiIPR007603. Choline_transptr-like.
[Graphical view]
PANTHERiPTHR12385. PTHR12385. 1 hit.
PfamiPF04515. Choline_transpo. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6X893-1) [UniParc]FASTAAdd to Basket

Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCCSSASAA QSSKREWKPL EDRSCTDIPW LLLFVLFCIG MGFICGFSVA
60 70 80 90 100
TGAAARLVSG YDSYGNICGQ RNAKLEAIPN SGLDHTHRKY VFFLDPCNLD
110 120 130 140 150
LINRKIKSIA LCVAACPRQE LKTLSDVQKF AEINGSALCS YNIKPSEYTL
160 170 180 190 200
TSKSSGFCPK LPVPASAPIP FFHRCAPVNI SCYAKFAEAL ITFVSDNSVL
210 220 230 240 250
HRLISGVMTS KEIILGLCLL SLVLSMILMV IIRYISRVLV WILTVLVILG
260 270 280 290 300
SLGGTGVLWW LYAKQRRSPK EAVIPEQLQI AEDNLRALLI YAISATVFTV
310 320 330 340 350
ILFLIMLVMR KRVALTIALF HVAGKVFIHL PLLVFQPFWT FFALVLFWAY
360 370 380 390 400
WIMTLLFLGT TGSAVQNEQG FVEYKISGPL QYMWWYHVVG LIWISEFILA
410 420 430 440 450
CQQMTVAGAV VTYYFTRDKR NLPFTPILAS VNRLIRYHLG TVAKGSFIIT
460 470 480 490 500
LVKIPRMVLM YIHSQLKGKE NACARCMLKS CICCLWCLEK CLSYLNQNAY
510 520 530 540 550
TATAINSTNF CTSAKDAFVI LVENALRVAA INTVGDFMLF LGKVLIVCST
560 570 580 590 600
GLAGIMLLNY QQDYTVWVLP LIIVCLFAFL VAHCFLSIYE MVVDVLFLCF
610 620 630 640 650
AIDTKYNDGS PGREFYMDKV LMEFVENSRK AMKEAGKGGA ADARELKPML

RKR
Length:653
Mass (Da):73,067
Last modified:July 27, 2011 - v3
Checksum:i639979730CFE5913
GO
Isoform 2 (identifier: Q6X893-2) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     650-653: LRKR → VGSEEEAAALHDFPFHFFSVCVFTDCTSSGEALVVCITQDMLLFLFACLPITWMAEVLSQLRLPSVKVS

Show »
Length:718
Mass (Da):80,094
Checksum:iBE6B6397D3E09F33
GO

Sequence cautioni

The sequence AAH25941.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti426 – 4261P → L in AAP81042. (PubMed:15474312)Curated
Sequence conflicti426 – 4261P → L in AAP81043. (PubMed:15474312)Curated
Sequence conflicti439 – 4391L → F in AAP81042. (PubMed:15474312)Curated
Sequence conflicti439 – 4391L → F in AAP81043. (PubMed:15474312)Curated
Sequence conflicti510 – 5101F → L in AAP81042. (PubMed:15474312)Curated
Sequence conflicti510 – 5101F → L in AAP81043. (PubMed:15474312)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei650 – 6534LRKR → VGSEEEAAALHDFPFHFFSV CVFTDCTSSGEALVVCITQD MLLFLFACLPITWMAEVLSQ LRLPSVKVS in isoform 2. 1 PublicationVSP_015428

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY249865 mRNA. Translation: AAP81042.1.
AY249866 mRNA. Translation: AAP81043.1.
AL807745, AL805900 Genomic DNA. Translation: CAM17555.1.
AL805900, AL807745 Genomic DNA. Translation: CAM27148.1.
BC010258 mRNA. Translation: AAH10258.1.
BC025941 mRNA. Translation: AAH25941.1. Different initiation.
BC113167 mRNA. Translation: AAI13168.1.
BC113169 mRNA. Translation: AAI13170.1.
CCDSiCCDS18189.1. [Q6X893-1]
RefSeqiNP_598652.3. NM_133891.3. [Q6X893-1]
UniGeneiMm.482207.
Mm.491170.

Genome annotation databases

EnsembliENSMUST00000102911; ENSMUSP00000099975; ENSMUSG00000028412. [Q6X893-1]
GeneIDi100434.
KEGGimmu:100434.
UCSCiuc008swz.2. mouse. [Q6X893-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY249865 mRNA. Translation: AAP81042.1 .
AY249866 mRNA. Translation: AAP81043.1 .
AL807745 , AL805900 Genomic DNA. Translation: CAM17555.1 .
AL805900 , AL807745 Genomic DNA. Translation: CAM27148.1 .
BC010258 mRNA. Translation: AAH10258.1 .
BC025941 mRNA. Translation: AAH25941.1 . Different initiation.
BC113167 mRNA. Translation: AAI13168.1 .
BC113169 mRNA. Translation: AAI13170.1 .
CCDSi CCDS18189.1. [Q6X893-1 ]
RefSeqi NP_598652.3. NM_133891.3. [Q6X893-1 ]
UniGenei Mm.482207.
Mm.491170.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10090.ENSMUSP00000103274.

Protein family/group databases

TCDBi 2.A.92.1.1. the choline transporter-like (ctl) family.

PTM databases

PhosphoSitei Q6X893.

Proteomic databases

MaxQBi Q6X893.
PaxDbi Q6X893.
PRIDEi Q6X893.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000102911 ; ENSMUSP00000099975 ; ENSMUSG00000028412 . [Q6X893-1 ]
GeneIDi 100434.
KEGGi mmu:100434.
UCSCi uc008swz.2. mouse. [Q6X893-1 ]

Organism-specific databases

CTDi 23446.
MGIi MGI:2140592. Slc44a1.

Phylogenomic databases

eggNOGi NOG310633.
GeneTreei ENSGT00550000074521.
HOGENOMi HOG000231655.
HOVERGENi HBG080361.
InParanoidi Q6X893.
KOi K06515.
OrthoDBi EOG72JWFP.
TreeFami TF313325.

Enzyme and pathway databases

Reactomei REACT_207335. Synthesis of PC.
REACT_217615. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Miscellaneous databases

NextBioi 354424.
PROi Q6X893.
SOURCEi Search...

Gene expression databases

Bgeei Q6X893.
CleanExi MM_SLC44A1.
ExpressionAtlasi Q6X893. baseline and differential.
Genevestigatori Q6X893.

Family and domain databases

InterProi IPR007603. Choline_transptr-like.
[Graphical view ]
PANTHERi PTHR12385. PTHR12385. 1 hit.
Pfami PF04515. Choline_transpo. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and expression of a mouse muscle-specific CTL1 gene."
    Yuan Z., Wagner L., Poloumienko A., Bakovic M.
    Gene 341:305-312(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, FUNCTION.
    Tissue: Fibroblast.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: FVB/N.
    Tissue: Liver and Mammary gland.
  4. "The solute carrier 44A1 is a mitochondrial protein and mediates choline transport."
    Michel V., Bakovic M.
    FASEB J. 23:2749-2758(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TOPOLOGY, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiCTL1_MOUSE
AccessioniPrimary (citable) accession number: Q6X893
Secondary accession number(s): Q14DK0
, Q6X894, Q8R0Y4, Q91Z29
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: July 27, 2011
Last modified: October 29, 2014
This is version 83 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3