Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuropeptide S receptor

Gene

NPSR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

G-protein coupled receptor for neuropeptide S (NPS) (PubMed:16790440). Promotes mobilization of intracellular Ca2+ stores (PubMed:16790440). Inhibits cell growth in response to NPS binding (PubMed:15947423). Involved in pathogenesis of asthma and other IgE-mediated diseases.3 Publications

Miscellaneous

Only isoforms with 7 transmembrane topology (isoform 1, isoform 3 and isoform 4) are transported into the plasma membrane in transfected cells, while the truncated ones retain intracellular compartments.1 Publication

Caution

GO - Molecular functioni

  • neuropeptide receptor activity Source: UniProtKB
  • vasopressin receptor activity Source: InterPro

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
R-HSA-418555 G alpha (s) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
Neuropeptide S receptor
Alternative name(s):
G-protein coupled receptor 154
G-protein coupled receptor PGR14
G-protein coupled receptor for asthma susceptibility
Gene namesi
Name:NPSR1
Synonyms:GPR154, GPRA, PGR14
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000187258.13
HGNCiHGNC:23631 NPSR1
MIMi608595 gene
neXtProtiNX_Q6W5P4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 52ExtracellularSequence analysisAdd BLAST52
Transmembranei53 – 73Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini74 – 82CytoplasmicSequence analysis9
Transmembranei83 – 103Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini104 – 123ExtracellularSequence analysisAdd BLAST20
Transmembranei124 – 144Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini145 – 164CytoplasmicSequence analysisAdd BLAST20
Transmembranei165 – 185Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini186 – 212ExtracellularSequence analysisAdd BLAST27
Transmembranei213 – 233Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini234 – 275CytoplasmicSequence analysisAdd BLAST42
Transmembranei276 – 296Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini297 – 312ExtracellularSequence analysisAdd BLAST16
Transmembranei313 – 333Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini334 – 371CytoplasmicSequence analysisAdd BLAST38

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Involvement in diseasei

Asthma-related traits 2 (ASRT2)3 Publications
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionAsthma-related traits include clinical symptoms of asthma, such as coughing, wheezing, dyspnea, bronchial hyperresponsiveness as assessed by methacholine challenge test, serum IgE levels, atopy and atopic dermatitis.
See also OMIM:608584

Keywords - Diseasei

Asthma

Organism-specific databases

DisGeNETi387129
MalaCardsiNPSR1
MIMi608584 phenotype
OpenTargetsiENSG00000187258
PharmGKBiPA134951416

Chemistry databases

ChEMBLiCHEMBL5162
DrugBankiDB01159 Halothane
GuidetoPHARMACOLOGYi302

Polymorphism and mutation databases

BioMutaiNPSR1
DMDMi74758626

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000696391 – 371Neuropeptide S receptorAdd BLAST371

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi4N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi121 ↔ 197PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ6W5P4
PaxDbiQ6W5P4
PeptideAtlasiQ6W5P4
PRIDEiQ6W5P4

PTM databases

iPTMnetiQ6W5P4
PhosphoSitePlusiQ6W5P4

Expressioni

Tissue specificityi

Isoform 4 is ubiquitous; it is detected in glandular epithelia of bronchus, stomach, small intestine, colon, uterus, esophagus, spleen, kidney, pancreas, prostate and breast. Isoform 1 is detected in uterus, colon and prostate, and in the smooth muscle cell layer in bronchial and arterial walls (at protein level) (PubMed:15947423). Isoform 1 is predominantly expressed in smooth muscle. Isoform 4 is predominantly expressed in epithelial cells. In bronchial biopsies, it is expressed in smooth muscle cells of asthma patients, but not in control patients; whereas in epithelial cells, its expression is consistently stronger in asthma patients.2 Publications

Gene expression databases

BgeeiENSG00000187258
ExpressionAtlasiQ6W5P4 baseline and differential

Organism-specific databases

HPAiHPA007489

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000352839

Chemistry databases

BindingDBiQ6W5P4

Structurei

3D structure databases

ProteinModelPortaliQ6W5P4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3184 Eukaryota
KOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00760000119156
HOVERGENiHBG106615
InParanoidiQ6W5P4
KOiK08376
OMAiTIWMKSK
OrthoDBiEOG091G0A5H
PhylomeDBiQ6W5P4
TreeFamiTF106499

Family and domain databases

InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR027294 NPS_rcpt
IPR001817 Vasoprsn_rcpt
PANTHERiPTHR24244:SF2 PTHR24244:SF2, 1 hit
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PR00896 VASOPRESSINR
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6W5P4-1) [UniParc]FASTAAdd to basket
Also known as: Isoform A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPANFTEGSF DSSGTGQTLD SSPVACTETV TFTEVVEGKE WGSFYYSFKT
60 70 80 90 100
EQLITLWVLF VFTIVGNSVV LFSTWRRKKK SRMTFFVTQL AITDSFTGLV
110 120 130 140 150
NILTDINWRF TGDFTAPDLV CRVVRYLQVV LLYASTYVLV SLSIDRYHAI
160 170 180 190 200
VYPMKFLQGE KQARVLIVIA WSLSFLFSIP TLIIFGKRTL SNGEVQCWAL
210 220 230 240 250
WPDDSYWTPY MTIVAFLVYF IPLTIISIMY GIVIRTIWIK SKTYETVISN
260 270 280 290 300
CSDGKLCSSY NRGLISKAKI KAIKYSIIII LAFICCWSPY FLFDILDNFN
310 320 330 340 350
LLPDTQERFY ASVIIQNLPA LNSAINPLIY CVFSSSISFP CREQRSQDSR
360 370
MTFRERTERH EMQILSKPEF I
Length:371
Mass (Da):42,687
Last modified:July 5, 2004 - v1
Checksum:iEA084B381562353D
GO
Isoform 2 (identifier: Q6W5P4-2) [UniParc]FASTAAdd to basket
Also known as: Isoform F

The sequence of this isoform differs from the canonical sequence as follows:
     94-159: Missing.

Show »
Length:305
Mass (Da):35,116
Checksum:i665844DF66FDDC89
GO
Isoform 3 (identifier: Q6W5P4-3) [UniParc]FASTAAdd to basket
Also known as: Isoform G

The sequence of this isoform differs from the canonical sequence as follows:
     343-371: EQRSQDSRMTFRERTERHEMQILSKPEFI → ANSSVYLLAC...GFQNDVPGEN

Show »
Length:390
Mass (Da):44,294
Checksum:i42FACA8D36EBAB1D
GO
Isoform 4 (identifier: Q6W5P4-4) [UniParc]FASTAAdd to basket
Also known as: Isoform B long form

The sequence of this isoform differs from the canonical sequence as follows:
     343-371: EQRSQDSRMTFRERTERHEMQILSKPEFI → VIRLRQLQEAALMLCPQRENWKGTWPGVPSWALPR

Show »
Length:377
Mass (Da):43,123
Checksum:i310B778C70C104B9
GO
Isoform 5 (identifier: Q6W5P4-5) [UniParc]FASTAAdd to basket
Also known as: Isoform B short form

The sequence of this isoform differs from the canonical sequence as follows:
     93-103: Missing.
     343-371: EQRSQDSRMTFRERTERHEMQILSKPEFI → VIRLRQLQEAALMLCPQRENWKGTWPGVPSWALPR

Show »
Length:366
Mass (Da):41,961
Checksum:i523DDC610B719DF0
GO
Isoform 6 (identifier: Q6W5P4-6) [UniParc]FASTAAdd to basket
Also known as: Isoform D

The sequence of this isoform differs from the canonical sequence as follows:
     94-158: DSFTGLVNIL...AIVYPMKFLQ → GCAALRLYLR...HIWEEDTVQR
     159-371: Missing.

Show »
Length:158
Mass (Da):18,043
Checksum:i3D69DADA95C6F873
GO
Isoform 7 (identifier: Q6W5P4-7) [UniParc]FASTAAdd to basket
Also known as: Isoform E

The sequence of this isoform differs from the canonical sequence as follows:
     129-136: VVLLYAST → KSKPGSSL
     137-371: Missing.

Show »
Length:136
Mass (Da):15,327
Checksum:i19AA8C544568D426
GO
Isoform 8 (identifier: Q6W5P4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     130-143: VLLYASTYVLVSLS → MVMKLFHIQKMNME
     144-371: Missing.

Note: No experimental confirmation available.
Show »
Length:143
Mass (Da):16,403
Checksum:i2F3C09CB873FDFA6
GO
Isoform 9 (identifier: Q6W5P4-9) [UniParc]FASTAAdd to basket
Also known as: Isoform C

The sequence of this isoform differs from the canonical sequence as follows:
     94-94: D → V
     95-371: Missing.

Show »
Length:94
Mass (Da):10,612
Checksum:i324E80DBCA39A3E8
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_023757107N → I Increases cell surface expression and NPS-dependent calcium mobilization; does not affect affinity for NPS.. 5 PublicationsCorresponds to variant dbSNP:rs324981Ensembl.1
Natural variantiVAR_025103122R → Q1 PublicationCorresponds to variant dbSNP:rs35436513Ensembl.1
Natural variantiVAR_025104143S → G1 PublicationCorresponds to variant dbSNP:rs325465Ensembl.1
Natural variantiVAR_025105197C → F1 PublicationCorresponds to variant dbSNP:rs34705969Ensembl.1
Natural variantiVAR_025106212T → I1 PublicationCorresponds to variant dbSNP:rs35537374Ensembl.1
Natural variantiVAR_023758241S → R1 PublicationCorresponds to variant dbSNP:rs727162Ensembl.1
Natural variantiVAR_025107315I → T1 PublicationCorresponds to variant dbSNP:rs10270766Ensembl.1
Natural variantiVAR_023759344Q → R1 PublicationCorresponds to variant dbSNP:rs6972158Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01607893 – 103Missing in isoform 5. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_01607994 – 159Missing in isoform 2. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_01608094 – 158DSFTG…MKFLQ → GCAALRLYLRPGVPQHRQIP CHRLPHEVPSRRKASQGPHC DRLEPVFSVLHSHPDHIWEE DTVQR in isoform 6. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_01608194D → V in isoform 9. 1 Publication1
Alternative sequenceiVSP_01608295 – 371Missing in isoform 9. 1 PublicationAdd BLAST277
Alternative sequenceiVSP_016083129 – 136VVLLYAST → KSKPGSSL in isoform 7. 1 Publication8
Alternative sequenceiVSP_016084130 – 143VLLYA…LVSLS → MVMKLFHIQKMNME in isoform 8. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_016085137 – 371Missing in isoform 7. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_016086144 – 371Missing in isoform 8. 1 PublicationAdd BLAST228
Alternative sequenceiVSP_016087159 – 371Missing in isoform 6. 1 PublicationAdd BLAST213
Alternative sequenceiVSP_016088343 – 371EQRSQ…KPEFI → ANSSVYLLACDVSVLWALVL TSEKESCESWRRKGAKITGF QNDVPGEN in isoform 3. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_016089343 – 371EQRSQ…KPEFI → VIRLRQLQEAALMLCPQREN WKGTWPGVPSWALPR in isoform 4 and isoform 5. 3 PublicationsAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY310326 mRNA Translation: AAQ76966.1
AY310327 mRNA Translation: AAQ76967.1
AY310328 mRNA Translation: AAQ76968.1
AY310329 mRNA Translation: AAQ76969.1
AY310330 mRNA Translation: AAQ76970.1
AY310331 mRNA Translation: AAQ76971.1
AY310332 mRNA Translation: AAQ76972.1
AY956446 mRNA Translation: AAX63744.1
AY956447 mRNA Translation: AAX63745.1
AY956448 mRNA Translation: AAX63746.1
AK172847 mRNA Translation: BAD18811.1
DQ272236 Genomic DNA Translation: ABB72550.1
CH471073 Genomic DNA Translation: EAW94036.1
BC132693 mRNA Translation: AAI32694.1
BC132695 mRNA Translation: AAI32696.1
CCDSiCCDS5443.1 [Q6W5P4-4]
CCDS5444.1 [Q6W5P4-1]
CCDS75579.1 [Q6W5P4-3]
CCDS75580.1 [Q6W5P4-5]
CCDS75581.1 [Q6W5P4-2]
RefSeqiNP_001287862.1, NM_001300933.1 [Q6W5P4-5]
NP_001287863.1, NM_001300934.1 [Q6W5P4-2]
NP_001287864.1, NM_001300935.1 [Q6W5P4-3]
NP_997055.1, NM_207172.1 [Q6W5P4-1]
NP_997056.1, NM_207173.1 [Q6W5P4-4]
UniGeneiHs.652373

Genome annotation databases

EnsembliENST00000359791; ENSP00000352839; ENSG00000187258 [Q6W5P4-4]
ENST00000360581; ENSP00000353788; ENSG00000187258 [Q6W5P4-1]
ENST00000381539; ENSP00000370950; ENSG00000187258 [Q6W5P4-3]
ENST00000381542; ENSP00000370953; ENSG00000187258 [Q6W5P4-2]
ENST00000381544; ENSP00000370955; ENSG00000187258 [Q6W5P4-6]
ENST00000381553; ENSP00000370965; ENSG00000187258 [Q6W5P4-8]
ENST00000396095; ENSP00000379402; ENSG00000187258 [Q6W5P4-7]
ENST00000465305; ENSP00000434955; ENSG00000187258 [Q6W5P4-9]
ENST00000531252; ENSP00000433258; ENSG00000187258 [Q6W5P4-5]
GeneIDi387129
KEGGihsa:387129
UCSCiuc003teg.1 human [Q6W5P4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiNPSR1_HUMAN
AccessioniPrimary (citable) accession number: Q6W5P4
Secondary accession number(s): A2RTZ4
, Q2XP58, Q56H76, Q56H77, Q56H78, Q6JSL4, Q6JSL5, Q6JSL6, Q6JSL7, Q6JSL8, Q6W5P3, Q6ZMB8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: July 5, 2004
Last modified: February 28, 2018
This is version 124 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome