Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuropeptide S receptor

Gene

NPSR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

G-protein coupled receptor for neuropeptide S (NPS) (PubMed:16790440). Promotes mobilization of intracellular Ca2+ stores (PubMed:16790440). Inhibits cell growth in response to NPS binding (PubMed:15947423). Involved in pathogenesis of asthma and other IgE-mediated diseases.3 Publications

GO - Molecular functioni

  • neuropeptide receptor activity Source: UniProtKB
  • vasopressin receptor activity Source: InterPro

GO - Biological processi

  • neuropeptide signaling pathway Source: UniProtKB
  • positive regulation of release of sequestered calcium ion into cytosol Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:G66-33350-MONOMER.
ReactomeiR-HSA-375276. Peptide ligand-binding receptors.
R-HSA-416476. G alpha (q) signalling events.
R-HSA-418555. G alpha (s) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Neuropeptide S receptor
Alternative name(s):
G-protein coupled receptor 154
G-protein coupled receptor PGR14
G-protein coupled receptor for asthma susceptibility
Gene namesi
Name:NPSR1
Synonyms:GPR154, GPRA, PGR14
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:23631. NPSR1.

Subcellular locationi

Isoform 1 :
Isoform 3 :
Isoform 4 :
Isoform 2 :
Isoform 5 :
Isoform 6 :
Isoform 7 :
Isoform 9 :

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 52ExtracellularSequence analysisAdd BLAST52
Transmembranei53 – 73Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini74 – 82CytoplasmicSequence analysis9
Transmembranei83 – 103Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini104 – 123ExtracellularSequence analysisAdd BLAST20
Transmembranei124 – 144Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini145 – 164CytoplasmicSequence analysisAdd BLAST20
Transmembranei165 – 185Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini186 – 212ExtracellularSequence analysisAdd BLAST27
Transmembranei213 – 233Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini234 – 275CytoplasmicSequence analysisAdd BLAST42
Transmembranei276 – 296Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini297 – 312ExtracellularSequence analysisAdd BLAST16
Transmembranei313 – 333Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini334 – 371CytoplasmicSequence analysisAdd BLAST38

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • integral component of plasma membrane Source: UniProtKB
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Involvement in diseasei

Asthma-related traits 2 (ASRT2)3 Publications
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionAsthma-related traits include clinical symptoms of asthma, such as coughing, wheezing, dyspnea, bronchial hyperresponsiveness as assessed by methacholine challenge test, serum IgE levels, atopy and atopic dermatitis.
See also OMIM:608584

Keywords - Diseasei

Asthma

Organism-specific databases

DisGeNETi387129.
MalaCardsiNPSR1.
MIMi608584. phenotype.
OpenTargetsiENSG00000187258.
PharmGKBiPA134951416.

Chemistry databases

ChEMBLiCHEMBL5162.
DrugBankiDB01159. Halothane.
GuidetoPHARMACOLOGYi302.

Polymorphism and mutation databases

BioMutaiNPSR1.
DMDMi74758626.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000696391 – 371Neuropeptide S receptorAdd BLAST371

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi4N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi121 ↔ 197PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ6W5P4.
PaxDbiQ6W5P4.
PeptideAtlasiQ6W5P4.
PRIDEiQ6W5P4.

PTM databases

iPTMnetiQ6W5P4.
PhosphoSitePlusiQ6W5P4.

Expressioni

Tissue specificityi

Isoform 4 is ubiquitous; it is detected in glandular epithelia of bronchus, stomach, small intestine, colon, uterus, esophagus, spleen, kidney, pancreas, prostate and breast. Isoform 1 is detected in uterus, colon and prostate, and in the smooth muscle cell layer in bronchial and arterial walls (at protein level) (PubMed:15947423). Isoform 1 is predominantly expressed in smooth muscle. Isoform 4 is predominantly expressed in epithelial cells. In bronchial biopsies, it is expressed in smooth muscle cells of asthma patients, but not in control patients; whereas in epithelial cells, its expression is consistently stronger in asthma patients.2 Publications

Gene expression databases

BgeeiENSG00000187258.
ExpressionAtlasiQ6W5P4. baseline and differential.

Organism-specific databases

HPAiHPA007489.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000352839.

Chemistry databases

BindingDBiQ6W5P4.

Structurei

3D structure databases

ProteinModelPortaliQ6W5P4.
SMRiQ6W5P4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3184. Eukaryota.
KOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000119156.
HOVERGENiHBG106615.
InParanoidiQ6W5P4.
KOiK08376.
OMAiTIWMKSK.
OrthoDBiEOG091G0A5H.
PhylomeDBiQ6W5P4.
TreeFamiTF106499.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR027294. NPS_rcpt.
IPR001817. Vasoprsn_rcpt.
[Graphical view]
PANTHERiPTHR24244:SF2. PTHR24244:SF2. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00896. VASOPRESSINR.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6W5P4-1) [UniParc]FASTAAdd to basket
Also known as: Isoform A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPANFTEGSF DSSGTGQTLD SSPVACTETV TFTEVVEGKE WGSFYYSFKT
60 70 80 90 100
EQLITLWVLF VFTIVGNSVV LFSTWRRKKK SRMTFFVTQL AITDSFTGLV
110 120 130 140 150
NILTDINWRF TGDFTAPDLV CRVVRYLQVV LLYASTYVLV SLSIDRYHAI
160 170 180 190 200
VYPMKFLQGE KQARVLIVIA WSLSFLFSIP TLIIFGKRTL SNGEVQCWAL
210 220 230 240 250
WPDDSYWTPY MTIVAFLVYF IPLTIISIMY GIVIRTIWIK SKTYETVISN
260 270 280 290 300
CSDGKLCSSY NRGLISKAKI KAIKYSIIII LAFICCWSPY FLFDILDNFN
310 320 330 340 350
LLPDTQERFY ASVIIQNLPA LNSAINPLIY CVFSSSISFP CREQRSQDSR
360 370
MTFRERTERH EMQILSKPEF I
Length:371
Mass (Da):42,687
Last modified:July 5, 2004 - v1
Checksum:iEA084B381562353D
GO
Isoform 2 (identifier: Q6W5P4-2) [UniParc]FASTAAdd to basket
Also known as: Isoform F

The sequence of this isoform differs from the canonical sequence as follows:
     94-159: Missing.

Show »
Length:305
Mass (Da):35,116
Checksum:i665844DF66FDDC89
GO
Isoform 3 (identifier: Q6W5P4-3) [UniParc]FASTAAdd to basket
Also known as: Isoform G

The sequence of this isoform differs from the canonical sequence as follows:
     343-371: EQRSQDSRMTFRERTERHEMQILSKPEFI → ANSSVYLLAC...GFQNDVPGEN

Show »
Length:390
Mass (Da):44,294
Checksum:i42FACA8D36EBAB1D
GO
Isoform 4 (identifier: Q6W5P4-4) [UniParc]FASTAAdd to basket
Also known as: Isoform B long form

The sequence of this isoform differs from the canonical sequence as follows:
     343-371: EQRSQDSRMTFRERTERHEMQILSKPEFI → VIRLRQLQEAALMLCPQRENWKGTWPGVPSWALPR

Show »
Length:377
Mass (Da):43,123
Checksum:i310B778C70C104B9
GO
Isoform 5 (identifier: Q6W5P4-5) [UniParc]FASTAAdd to basket
Also known as: Isoform B short form

The sequence of this isoform differs from the canonical sequence as follows:
     93-103: Missing.
     343-371: EQRSQDSRMTFRERTERHEMQILSKPEFI → VIRLRQLQEAALMLCPQRENWKGTWPGVPSWALPR

Show »
Length:366
Mass (Da):41,961
Checksum:i523DDC610B719DF0
GO
Isoform 6 (identifier: Q6W5P4-6) [UniParc]FASTAAdd to basket
Also known as: Isoform D

The sequence of this isoform differs from the canonical sequence as follows:
     94-158: DSFTGLVNIL...AIVYPMKFLQ → GCAALRLYLR...HIWEEDTVQR
     159-371: Missing.

Show »
Length:158
Mass (Da):18,043
Checksum:i3D69DADA95C6F873
GO
Isoform 7 (identifier: Q6W5P4-7) [UniParc]FASTAAdd to basket
Also known as: Isoform E

The sequence of this isoform differs from the canonical sequence as follows:
     129-136: VVLLYAST → KSKPGSSL
     137-371: Missing.

Show »
Length:136
Mass (Da):15,327
Checksum:i19AA8C544568D426
GO
Isoform 8 (identifier: Q6W5P4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     130-143: VLLYASTYVLVSLS → MVMKLFHIQKMNME
     144-371: Missing.

Note: No experimental confirmation available.
Show »
Length:143
Mass (Da):16,403
Checksum:i2F3C09CB873FDFA6
GO
Isoform 9 (identifier: Q6W5P4-9) [UniParc]FASTAAdd to basket
Also known as: Isoform C

The sequence of this isoform differs from the canonical sequence as follows:
     94-94: D → V
     95-371: Missing.

Show »
Length:94
Mass (Da):10,612
Checksum:i324E80DBCA39A3E8
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_023757107N → I Increases cell surface expression and NPS-dependent calcium mobilization; does not affect affinity for NPS.. 5 PublicationsCorresponds to variant rs324981dbSNPEnsembl.1
Natural variantiVAR_025103122R → Q.1 PublicationCorresponds to variant rs35436513dbSNPEnsembl.1
Natural variantiVAR_025104143S → G.1 PublicationCorresponds to variant rs325465dbSNPEnsembl.1
Natural variantiVAR_025105197C → F.1 PublicationCorresponds to variant rs34705969dbSNPEnsembl.1
Natural variantiVAR_025106212T → I.1 PublicationCorresponds to variant rs35537374dbSNPEnsembl.1
Natural variantiVAR_023758241S → R.1 PublicationCorresponds to variant rs727162dbSNPEnsembl.1
Natural variantiVAR_025107315I → T.1 PublicationCorresponds to variant rs10270766dbSNPEnsembl.1
Natural variantiVAR_023759344Q → R.1 PublicationCorresponds to variant rs6972158dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01607893 – 103Missing in isoform 5. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_01607994 – 159Missing in isoform 2. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_01608094 – 158DSFTG…MKFLQ → GCAALRLYLRPGVPQHRQIP CHRLPHEVPSRRKASQGPHC DRLEPVFSVLHSHPDHIWEE DTVQR in isoform 6. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_01608194D → V in isoform 9. 1 Publication1
Alternative sequenceiVSP_01608295 – 371Missing in isoform 9. 1 PublicationAdd BLAST277
Alternative sequenceiVSP_016083129 – 136VVLLYAST → KSKPGSSL in isoform 7. 1 Publication8
Alternative sequenceiVSP_016084130 – 143VLLYA…LVSLS → MVMKLFHIQKMNME in isoform 8. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_016085137 – 371Missing in isoform 7. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_016086144 – 371Missing in isoform 8. 1 PublicationAdd BLAST228
Alternative sequenceiVSP_016087159 – 371Missing in isoform 6. 1 PublicationAdd BLAST213
Alternative sequenceiVSP_016088343 – 371EQRSQ…KPEFI → ANSSVYLLACDVSVLWALVL TSEKESCESWRRKGAKITGF QNDVPGEN in isoform 3. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_016089343 – 371EQRSQ…KPEFI → VIRLRQLQEAALMLCPQREN WKGTWPGVPSWALPR in isoform 4 and isoform 5. 3 PublicationsAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY310326 mRNA. Translation: AAQ76966.1.
AY310327 mRNA. Translation: AAQ76967.1.
AY310328 mRNA. Translation: AAQ76968.1.
AY310329 mRNA. Translation: AAQ76969.1.
AY310330 mRNA. Translation: AAQ76970.1.
AY310331 mRNA. Translation: AAQ76971.1.
AY310332 mRNA. Translation: AAQ76972.1.
AY956446 mRNA. Translation: AAX63744.1.
AY956447 mRNA. Translation: AAX63745.1.
AY956448 mRNA. Translation: AAX63746.1.
AK172847 mRNA. Translation: BAD18811.1.
DQ272236 Genomic DNA. Translation: ABB72550.1.
CH471073 Genomic DNA. Translation: EAW94036.1.
BC132693 mRNA. Translation: AAI32694.1.
BC132695 mRNA. Translation: AAI32696.1.
CCDSiCCDS5443.1. [Q6W5P4-4]
CCDS5444.1. [Q6W5P4-1]
CCDS75579.1. [Q6W5P4-3]
CCDS75580.1. [Q6W5P4-5]
CCDS75581.1. [Q6W5P4-2]
RefSeqiNP_001287862.1. NM_001300933.1. [Q6W5P4-5]
NP_001287863.1. NM_001300934.1. [Q6W5P4-2]
NP_001287864.1. NM_001300935.1. [Q6W5P4-3]
NP_997055.1. NM_207172.1. [Q6W5P4-1]
NP_997056.1. NM_207173.1. [Q6W5P4-4]
UniGeneiHs.652373.

Genome annotation databases

EnsembliENST00000359791; ENSP00000352839; ENSG00000187258. [Q6W5P4-4]
ENST00000360581; ENSP00000353788; ENSG00000187258. [Q6W5P4-1]
ENST00000381539; ENSP00000370950; ENSG00000187258. [Q6W5P4-3]
ENST00000381542; ENSP00000370953; ENSG00000187258. [Q6W5P4-2]
ENST00000381544; ENSP00000370955; ENSG00000187258. [Q6W5P4-6]
ENST00000381553; ENSP00000370965; ENSG00000187258. [Q6W5P4-8]
ENST00000396095; ENSP00000379402; ENSG00000187258. [Q6W5P4-7]
ENST00000465305; ENSP00000434955; ENSG00000187258. [Q6W5P4-9]
ENST00000531252; ENSP00000433258; ENSG00000187258. [Q6W5P4-5]
GeneIDi387129.
KEGGihsa:387129.
UCSCiuc003teg.1. human. [Q6W5P4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY310326 mRNA. Translation: AAQ76966.1.
AY310327 mRNA. Translation: AAQ76967.1.
AY310328 mRNA. Translation: AAQ76968.1.
AY310329 mRNA. Translation: AAQ76969.1.
AY310330 mRNA. Translation: AAQ76970.1.
AY310331 mRNA. Translation: AAQ76971.1.
AY310332 mRNA. Translation: AAQ76972.1.
AY956446 mRNA. Translation: AAX63744.1.
AY956447 mRNA. Translation: AAX63745.1.
AY956448 mRNA. Translation: AAX63746.1.
AK172847 mRNA. Translation: BAD18811.1.
DQ272236 Genomic DNA. Translation: ABB72550.1.
CH471073 Genomic DNA. Translation: EAW94036.1.
BC132693 mRNA. Translation: AAI32694.1.
BC132695 mRNA. Translation: AAI32696.1.
CCDSiCCDS5443.1. [Q6W5P4-4]
CCDS5444.1. [Q6W5P4-1]
CCDS75579.1. [Q6W5P4-3]
CCDS75580.1. [Q6W5P4-5]
CCDS75581.1. [Q6W5P4-2]
RefSeqiNP_001287862.1. NM_001300933.1. [Q6W5P4-5]
NP_001287863.1. NM_001300934.1. [Q6W5P4-2]
NP_001287864.1. NM_001300935.1. [Q6W5P4-3]
NP_997055.1. NM_207172.1. [Q6W5P4-1]
NP_997056.1. NM_207173.1. [Q6W5P4-4]
UniGeneiHs.652373.

3D structure databases

ProteinModelPortaliQ6W5P4.
SMRiQ6W5P4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000352839.

Chemistry databases

BindingDBiQ6W5P4.
ChEMBLiCHEMBL5162.
DrugBankiDB01159. Halothane.
GuidetoPHARMACOLOGYi302.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiQ6W5P4.
PhosphoSitePlusiQ6W5P4.

Polymorphism and mutation databases

BioMutaiNPSR1.
DMDMi74758626.

Proteomic databases

EPDiQ6W5P4.
PaxDbiQ6W5P4.
PeptideAtlasiQ6W5P4.
PRIDEiQ6W5P4.

Protocols and materials databases

DNASUi387129.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359791; ENSP00000352839; ENSG00000187258. [Q6W5P4-4]
ENST00000360581; ENSP00000353788; ENSG00000187258. [Q6W5P4-1]
ENST00000381539; ENSP00000370950; ENSG00000187258. [Q6W5P4-3]
ENST00000381542; ENSP00000370953; ENSG00000187258. [Q6W5P4-2]
ENST00000381544; ENSP00000370955; ENSG00000187258. [Q6W5P4-6]
ENST00000381553; ENSP00000370965; ENSG00000187258. [Q6W5P4-8]
ENST00000396095; ENSP00000379402; ENSG00000187258. [Q6W5P4-7]
ENST00000465305; ENSP00000434955; ENSG00000187258. [Q6W5P4-9]
ENST00000531252; ENSP00000433258; ENSG00000187258. [Q6W5P4-5]
GeneIDi387129.
KEGGihsa:387129.
UCSCiuc003teg.1. human. [Q6W5P4-1]

Organism-specific databases

CTDi387129.
DisGeNETi387129.
GeneCardsiNPSR1.
HGNCiHGNC:23631. NPSR1.
HPAiHPA007489.
MalaCardsiNPSR1.
MIMi608584. phenotype.
608595. gene.
neXtProtiNX_Q6W5P4.
OpenTargetsiENSG00000187258.
PharmGKBiPA134951416.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3184. Eukaryota.
KOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000119156.
HOVERGENiHBG106615.
InParanoidiQ6W5P4.
KOiK08376.
OMAiTIWMKSK.
OrthoDBiEOG091G0A5H.
PhylomeDBiQ6W5P4.
TreeFamiTF106499.

Enzyme and pathway databases

BioCyciZFISH:G66-33350-MONOMER.
ReactomeiR-HSA-375276. Peptide ligand-binding receptors.
R-HSA-416476. G alpha (q) signalling events.
R-HSA-418555. G alpha (s) signalling events.

Miscellaneous databases

GeneWikiiNeuropeptide_S_receptor.
GenomeRNAii387129.
PROiQ6W5P4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000187258.
ExpressionAtlasiQ6W5P4. baseline and differential.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR027294. NPS_rcpt.
IPR001817. Vasoprsn_rcpt.
[Graphical view]
PANTHERiPTHR24244:SF2. PTHR24244:SF2. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00896. VASOPRESSINR.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNPSR1_HUMAN
AccessioniPrimary (citable) accession number: Q6W5P4
Secondary accession number(s): A2RTZ4
, Q2XP58, Q56H76, Q56H77, Q56H78, Q6JSL4, Q6JSL5, Q6JSL6, Q6JSL7, Q6JSL8, Q6W5P3, Q6ZMB8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: July 5, 2004
Last modified: November 2, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Only isoforms with 7 transmembrane topology (isoform 1, isoform 3 and isoform 4) are transported into the plasma membrane in transfected cells, while the truncated ones retain intracellular compartments.1 Publication

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.