Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NT-3 growth factor receptor

Gene

Ntrk3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/AKT and the MAPK pathways, that control cell survival and differentiation.By similarity

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei572ATPPROSITE-ProRule annotation1
Active sitei679Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi544 – 552ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase
Biological processDifferentiation, Neurogenesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-388844 Receptor-type tyrosine-protein phosphatases

Names & Taxonomyi

Protein namesi
Recommended name:
NT-3 growth factor receptor (EC:2.7.10.1)
Alternative name(s):
GP145-TrkC
Short name:
Trk-C
Neurotrophic tyrosine kinase receptor type 3
TrkC tyrosine kinase
Gene namesi
Name:Ntrk3
Synonyms:TrkC
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:97385 Ntrk3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini32 – 429ExtracellularSequence analysisAdd BLAST398
Transmembranei430 – 453HelicalSequence analysisAdd BLAST24
Topological domaini454 – 825CytoplasmicSequence analysisAdd BLAST372

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL2791

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 31By similarityAdd BLAST31
ChainiPRO_000026043432 – 825NT-3 growth factor receptorAdd BLAST794

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi32 ↔ 38By similarity
Disulfide bondi36 ↔ 45By similarity
Glycosylationi68N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi72N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi79N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi133N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi163N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi164 ↔ 189By similarity
Disulfide bondi166 ↔ 207By similarity
Glycosylationi203N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi218N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi231 ↔ 284By similarity
Glycosylationi232N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi259N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi267N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi272N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi294N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi320 ↔ 362PROSITE-ProRule annotation
Glycosylationi375N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi388N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei493PhosphoserineCombined sources1
Modified residuei516PhosphotyrosineCombined sources1
Modified residuei705Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei709Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei710Phosphotyrosine; by autocatalysisBy similarity1

Post-translational modificationi

Ligand-mediated auto-phosphorylation.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ6VNS1
PeptideAtlasiQ6VNS1
PRIDEiQ6VNS1

PTM databases

iPTMnetiQ6VNS1
PhosphoSitePlusiQ6VNS1

Expressioni

Tissue specificityi

Isoform 2 expression is restricted to specific areas in adult brain. Isoform 3 transcripts are readily detected early during embryogenesis and are expressed predominantly in adult brain and gonads.1 Publication

Inductioni

Expression oscillates in a circadian manner in the liver.1 Publication

Gene expression databases

BgeeiENSMUSG00000059146
CleanExiMM_NTRK3
ExpressionAtlasiQ6VNS1 baseline and differential
GenevisibleiQ6VNS1 MM

Interactioni

Subunit structurei

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures (By similarity). Binds SH2B2. Interacts with SQSTM1 and KIDINS220 (By similarity). Interacts with PTPRS (PubMed:25385546).By similarity1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei516Interaction with SHC1By similarity1
Sitei820Interaction with PLC-gamma-1By similarity1

GO - Molecular functioni

Protein-protein interaction databases

BioGridi201870, 1 interactor
IntActiQ6VNS1, 1 interactor
STRINGi10090.ENSMUSP00000037909

Structurei

3D structure databases

ProteinModelPortaliQ6VNS1
SMRiQ6VNS1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati104 – 125LRR 1Add BLAST22
Repeati128 – 149LRR 2Add BLAST22
Domaini160 – 209LRRCTAdd BLAST50
Domaini210 – 300Ig-like C2-type 1Add BLAST91
Domaini309 – 382Ig-like C2-type 2Add BLAST74
Domaini538 – 825Protein kinasePROSITE-ProRule annotationAdd BLAST288

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1026 Eukaryota
ENOG410YGKQ LUCA
GeneTreeiENSGT00760000118818
HOGENOMiHOG000264255
HOVERGENiHBG056735
InParanoidiQ6VNS1
KOiK05101
PhylomeDBiQ6VNS1
TreeFamiTF106465

Family and domain databases

Gene3Di2.60.40.10, 2 hits
3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR000483 Cys-rich_flank_reg_C
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR013151 Immunoglobulin
IPR011009 Kinase-like_dom_sf
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR000372 LRRNT
IPR031635 NTRK_C2
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR020446 Tyr_kin_neurotrophic_rcpt_3
IPR008266 Tyr_kinase_AS
IPR020635 Tyr_kinase_cat_dom
IPR020777 Tyr_kinase_NGF_rcpt
IPR002011 Tyr_kinase_rcpt_2_CS
PfamiView protein in Pfam
PF07679 I-set, 1 hit
PF00047 ig, 1 hit
PF13855 LRR_8, 1 hit
PF01462 LRRNT, 1 hit
PF07714 Pkinase_Tyr, 1 hit
PF16920 TPKR_C2, 1 hit
PRINTSiPR01939 NTKRECEPTOR
PR01942 NTKRECEPTOR3
PR00109 TYRKINASE
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00082 LRRCT, 1 hit
SM00013 LRRNT, 1 hit
SM00219 TyrKc, 1 hit
SUPFAMiSSF48726 SSF48726, 2 hits
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
PS51450 LRR, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00109 PROTEIN_KINASE_TYR, 1 hit
PS00239 RECEPTOR_TYR_KIN_II, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6VNS1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVSLCPAKC SFWRIFLLGS VWLDYVGSVL ACPANCVCSK TEINCRRPDD
60 70 80 90 100
GNLFPLLEGQ DSGNSNGNAS INITDISRNI TSIHIENWRG LHTLNAVDME
110 120 130 140 150
LYTGLQKLTI KNSGLRNIQP RAFAKNPHLR YINLSSNRLT TLSWQLFQTL
160 170 180 190 200
SLRELRLEQN FFNCSCDIRW MQLWQEQGEA RLDSQSLYCI SADGSQLPLF
210 220 230 240 250
RMNISQCDLP EISVSHVNLT VREGDNAVIT CNGSGSPLPD VDWIVTGLQS
260 270 280 290 300
INTHQTNLNW TNVHAINLTL VNVTSEDNGF TLTCIAENVV GMSNASVALT
310 320 330 340 350
VYYPPRVVSL VEPEVRLEHC IEFVVRGNPT PTLHWLYNGQ PLRESKIIHM
360 370 380 390 400
DYYQEGEVSE GCLLFNKPTH YNNGNYTLIA KNALGTANQT INGHFLKEPF
410 420 430 440 450
PESTDFFDFE SDASPTPPIT VTHKPEEDTF GVSIAVGLAA FACVLLVVLF
460 470 480 490 500
IMINKYGRRS KFGMKGPVAV ISGEEDSASP LHHINHGITT PSSLDAGPDT
510 520 530 540 550
VVIGMTRIPV IENPQYFRQG HNCHKPDTYV QHIKRRDIVL KRELGEGAFG
560 570 580 590 600
KVFLAECYNL SPTKDKMLVA VKALKDPTLA ARKDFQREAE LLTNLQHEHI
610 620 630 640 650
VKFYGVCGDG DPLIMVFEYM KHGDLNKFLR AHGPDAMILV DGQPRQAKGE
660 670 680 690 700
LGLSQMLHIA SQIASGMVYL ASQHFVHRDL ATRNCLVGAN LLVKIGDFGM
710 720 730 740 750
SRDVYSTDYY RVGGHTMLPI RWMPPESIMY RKFTTESDVW SFGVILWEIF
760 770 780 790 800
TYGKQPWFQL SNTEVIECIT QGRVLERPRV CPKEVYDVML GCWQREPQQR
810 820
LNIKEIYKIL HALGKATPIY LDILG
Length:825
Mass (Da):92,760
Last modified:July 5, 2004 - v1
Checksum:i4DE08AB546CC5BD6
GO
Isoform 2 (identifier: Q6VNS1-2) [UniParc]FASTAAdd to basket
Also known as: TrkC NC1

The sequence of this isoform differs from the canonical sequence as follows:
     467-502: PVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVV → KVLFFQSQEFHGFHLLIKRYCTSICSLRKPLVTGPW
     503-825: Missing.

Note: Non-catalytic.
Show »
Length:502
Mass (Da):56,352
Checksum:i535D9ED9D7AF50CC
GO
Isoform 3 (identifier: Q6VNS1-3) [UniParc]FASTAAdd to basket
Also known as: TrkC NC2

The sequence of this isoform differs from the canonical sequence as follows:
     529-612: YVQHIKRRDI...FYGVCGDGDP → WVFSNIDNHG...VYFSKGRHGF
     613-825: Missing.

Note: Non-catalytic.
Show »
Length:612
Mass (Da):68,387
Checksum:i376F0F449792CE46
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti366N → K in AAC72289 (PubMed:9802700).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_021596467 – 502PVAVI…PDTVV → KVLFFQSQEFHGFHLLIKRY CTSICSLRKPLVTGPW in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_021597503 – 825Missing in isoform 2. 1 PublicationAdd BLAST323
Alternative sequenceiVSP_021598529 – 612YVQHI…GDGDP → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGFREIMLNPISLSGH SKPLNHGIYVEDVNVYFSKG RHGF in isoform 3. 2 PublicationsAdd BLAST84
Alternative sequenceiVSP_021599613 – 825Missing in isoform 3. 2 PublicationsAdd BLAST213

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY336094 mRNA Translation: AAP94280.1
AF035399 mRNA Translation: AAC72289.1
AF035400 mRNA Translation: AAC72290.1
BC139764 mRNA Translation: AAI39765.1
CCDSiCCDS21371.1 [Q6VNS1-1]
CCDS21372.1 [Q6VNS1-3]
RefSeqiNP_032772.3, NM_008746.5 [Q6VNS1-1]
NP_877961.1, NM_182809.2 [Q6VNS1-3]
UniGeneiMm.119373
Mm.33496
Mm.421361

Genome annotation databases

EnsembliENSMUST00000039431; ENSMUSP00000037909; ENSMUSG00000059146 [Q6VNS1-1]
ENSMUST00000039438; ENSMUSP00000038324; ENSMUSG00000059146 [Q6VNS1-3]
GeneIDi18213
KEGGimmu:18213
UCSCiuc009hxf.2 mouse [Q6VNS1-1]
uc009hxh.2 mouse [Q6VNS1-3]
uc009hxi.2 mouse [Q6VNS1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNTRK3_MOUSE
AccessioniPrimary (citable) accession number: Q6VNS1
Secondary accession number(s): A4QPD0, Q9Z2P9, Q9Z2Q0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: July 5, 2004
Last modified: May 23, 2018
This is version 133 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health