Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6VNS1 (NTRK3_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 101. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
NT-3 growth factor receptor

EC=2.7.10.1
Alternative name(s):
GP145-TrkC
Short name=Trk-C
Neurotrophic tyrosine kinase receptor type 3
TrkC tyrosine kinase
Gene names
Name:Ntrk3
Synonyms:TrkC
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length825 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the Trk receptors are SHC1, PI 3-kinase, and PLC-gamma-1 By similarity.

Catalytic activity

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Subunit structure

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. Binds SH2B2. Interacts with SQSTM1 and KIDINS220 By similarity.

Subcellular location

Membrane; Single-pass type I membrane protein By similarity.

Tissue specificity

Isoform 2 expression is restricted to specific areas in adult brain. Isoform 3 transcripts are readily detected early during embryogenesis and are expressed predominantly in adult brain and gonads. Ref.2

Post-translational modification

Ligand-mediated auto-phosphorylation By similarity.

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.

Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

Contains 2 LRR (leucine-rich) repeats.

Contains 1 LRRCT domain.

Contains 1 protein kinase domain.

Ontologies

Keywords
   Biological processDifferentiation
Neurogenesis
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainImmunoglobulin domain
Leucine-rich repeat
Repeat
Signal
Transmembrane
Transmembrane helix
   LigandATP-binding
Nucleotide-binding
   Molecular functionDevelopmental protein
Kinase
Receptor
Transferase
Tyrosine-protein kinase
   PTMDisulfide bond
Glycoprotein
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processactivation of MAPK activity

Inferred from electronic annotation. Source: Ensembl

activation of Ras GTPase activity

Inferred from electronic annotation. Source: Ensembl

activation of protein kinase B activity

Inferred from electronic annotation. Source: Ensembl

cellular response to retinoic acid

Inferred from electronic annotation. Source: Ensembl

cochlea development

Inferred from electronic annotation. Source: Ensembl

lens fiber cell differentiation

Inferred from genetic interaction PubMed 23136392. Source: MGI

mechanoreceptor differentiation

Inferred from mutant phenotype PubMed 15376326. Source: MGI

modulation by virus of host transcription

Inferred from electronic annotation. Source: Ensembl

negative regulation of astrocyte differentiation

Inferred from electronic annotation. Source: Ensembl

negative regulation of cell death

Inferred from electronic annotation. Source: Ensembl

negative regulation of protein phosphorylation

Inferred from electronic annotation. Source: Ensembl

neuron fate specification

Inferred from electronic annotation. Source: Ensembl

neuron migration

Inferred from electronic annotation. Source: Ensembl

positive regulation of actin cytoskeleton reorganization

Inferred from electronic annotation. Source: Ensembl

positive regulation of axon extension involved in regeneration

Inferred from genetic interaction PubMed 16142215. Source: MGI

positive regulation of cell migration

Inferred from electronic annotation. Source: Ensembl

positive regulation of cell proliferation

Inferred from electronic annotation. Source: Ensembl

positive regulation of gene expression

Inferred from electronic annotation. Source: Ensembl

positive regulation of peptidyl-serine phosphorylation

Inferred from electronic annotation. Source: Ensembl

positive regulation of positive chemotaxis

Inferred from electronic annotation. Source: Ensembl

protein autophosphorylation

Inferred from electronic annotation. Source: Ensembl

response to axon injury

Inferred from electronic annotation. Source: Ensembl

response to corticosterone

Inferred from electronic annotation. Source: Ensembl

response to ethanol

Inferred from electronic annotation. Source: Ensembl

transmembrane receptor protein tyrosine kinase signaling pathway

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcytoplasm

Inferred from direct assay PubMed 10207144. Source: MGI

integral component of plasma membrane

Inferred from electronic annotation. Source: InterPro

receptor complex

Inferred from sequence orthology PubMed 23382219. Source: MGI

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

neurotrophin receptor activity

Inferred from electronic annotation. Source: Ensembl

transmembrane receptor protein tyrosine kinase activity

Inferred from electronic annotation. Source: UniProtKB-EC

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6VNS1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6VNS1-2)

Also known as: TrkC NC1;

The sequence of this isoform differs from the canonical sequence as follows:
     467-502: PVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVV → KVLFFQSQEFHGFHLLIKRYCTSICSLRKPLVTGPW
     503-825: Missing.
Note: Non-catalytic.
Isoform 3 (identifier: Q6VNS1-3)

Also known as: TrkC NC2;

The sequence of this isoform differs from the canonical sequence as follows:
     529-612: YVQHIKRRDI...FYGVCGDGDP → WVFSNIDNHG...VYFSKGRHGF
     613-825: Missing.
Note: Non-catalytic.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3131 By similarity
Chain32 – 825794NT-3 growth factor receptor
PRO_0000260434

Regions

Topological domain32 – 429398Extracellular Potential
Transmembrane430 – 45324Helical; Potential
Topological domain454 – 825372Cytoplasmic Potential
Repeat104 – 12522LRR 1
Repeat128 – 14922LRR 2
Domain160 – 20950LRRCT
Domain210 – 30091Ig-like C2-type 1
Domain309 – 38274Ig-like C2-type 2
Domain538 – 825288Protein kinase
Nucleotide binding544 – 5529ATP By similarity

Sites

Active site6791Proton acceptor By similarity
Binding site5721ATP By similarity
Site5161Interaction with SHC1 By similarity
Site8201Interaction with PLC-gamma-1 By similarity

Amino acid modifications

Modified residue5161Phosphotyrosine; alternate Ref.4
Modified residue5161Phosphotyrosine; by autocatalysis; alternate By similarity
Modified residue7051Phosphotyrosine; by autocatalysis By similarity
Modified residue7091Phosphotyrosine; by autocatalysis By similarity
Modified residue7101Phosphotyrosine; by autocatalysis By similarity
Glycosylation681N-linked (GlcNAc...) Potential
Glycosylation721N-linked (GlcNAc...) Potential
Glycosylation791N-linked (GlcNAc...) Potential
Glycosylation1331N-linked (GlcNAc...) Potential
Glycosylation1631N-linked (GlcNAc...) Potential
Glycosylation2031N-linked (GlcNAc...) Potential
Glycosylation2181N-linked (GlcNAc...) Potential
Glycosylation2321N-linked (GlcNAc...) Potential
Glycosylation2591N-linked (GlcNAc...) Potential
Glycosylation2671N-linked (GlcNAc...) Potential
Glycosylation2721N-linked (GlcNAc...) Potential
Glycosylation2941N-linked (GlcNAc...) Potential
Glycosylation3751N-linked (GlcNAc...) Potential
Glycosylation3881N-linked (GlcNAc...) Potential
Disulfide bond320 ↔ 362 By similarity

Natural variations

Alternative sequence467 – 50236PVAVI…PDTVV → KVLFFQSQEFHGFHLLIKRY CTSICSLRKPLVTGPW in isoform 2.
VSP_021596
Alternative sequence503 – 825323Missing in isoform 2.
VSP_021597
Alternative sequence529 – 61284YVQHI…GDGDP → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGFREIMLNPISLSGH SKPLNHGIYVEDVNVYFSKG RHGF in isoform 3.
VSP_021598
Alternative sequence613 – 825213Missing in isoform 3.
VSP_021599

Experimental info

Sequence conflict3661N → K in AAC72289. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 4DE08AB546CC5BD6

FASTA82592,760
        10         20         30         40         50         60 
MDVSLCPAKC SFWRIFLLGS VWLDYVGSVL ACPANCVCSK TEINCRRPDD GNLFPLLEGQ 

        70         80         90        100        110        120 
DSGNSNGNAS INITDISRNI TSIHIENWRG LHTLNAVDME LYTGLQKLTI KNSGLRNIQP 

       130        140        150        160        170        180 
RAFAKNPHLR YINLSSNRLT TLSWQLFQTL SLRELRLEQN FFNCSCDIRW MQLWQEQGEA 

       190        200        210        220        230        240 
RLDSQSLYCI SADGSQLPLF RMNISQCDLP EISVSHVNLT VREGDNAVIT CNGSGSPLPD 

       250        260        270        280        290        300 
VDWIVTGLQS INTHQTNLNW TNVHAINLTL VNVTSEDNGF TLTCIAENVV GMSNASVALT 

       310        320        330        340        350        360 
VYYPPRVVSL VEPEVRLEHC IEFVVRGNPT PTLHWLYNGQ PLRESKIIHM DYYQEGEVSE 

       370        380        390        400        410        420 
GCLLFNKPTH YNNGNYTLIA KNALGTANQT INGHFLKEPF PESTDFFDFE SDASPTPPIT 

       430        440        450        460        470        480 
VTHKPEEDTF GVSIAVGLAA FACVLLVVLF IMINKYGRRS KFGMKGPVAV ISGEEDSASP 

       490        500        510        520        530        540 
LHHINHGITT PSSLDAGPDT VVIGMTRIPV IENPQYFRQG HNCHKPDTYV QHIKRRDIVL 

       550        560        570        580        590        600 
KRELGEGAFG KVFLAECYNL SPTKDKMLVA VKALKDPTLA ARKDFQREAE LLTNLQHEHI 

       610        620        630        640        650        660 
VKFYGVCGDG DPLIMVFEYM KHGDLNKFLR AHGPDAMILV DGQPRQAKGE LGLSQMLHIA 

       670        680        690        700        710        720 
SQIASGMVYL ASQHFVHRDL ATRNCLVGAN LLVKIGDFGM SRDVYSTDYY RVGGHTMLPI 

       730        740        750        760        770        780 
RWMPPESIMY RKFTTESDVW SFGVILWEIF TYGKQPWFQL SNTEVIECIT QGRVLERPRV 

       790        800        810        820 
CPKEVYDVML GCWQREPQQR LNIKEIYKIL HALGKATPIY LDILG 

« Hide

Isoform 2 (TrkC NC1) [UniParc].

Checksum: 535D9ED9D7AF50CC
Show »

FASTA50256,352
Isoform 3 (TrkC NC2) [UniParc].

Checksum: 376F0F449792CE46
Show »

FASTA61268,387

References

« Hide 'large scale' references
[1]"Neurotrophin 3 activation of TrkC induces Schwann cell migration through the c-Jun N-terminal kinase pathway."
Yamauchi J., Chan J.R., Shooter E.M.
Proc. Natl. Acad. Sci. U.S.A. 100:14421-14426(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: BALB/c.
[2]"Differential expression of TrkC catalytic and noncatalytic isoforms suggests that they act independently or in association."
Menn B., Timsit S., Calothy G., Lamballe F.
J. Comp. Neurol. 401:47-64(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY.
Strain: C57BL/6.
Tissue: Brain.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
[4]"Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-516, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY336094 mRNA. Translation: AAP94280.1.
AF035399 mRNA. Translation: AAC72289.1.
AF035400 mRNA. Translation: AAC72290.1.
BC139764 mRNA. Translation: AAI39765.1.
RefSeqNP_032772.3. NM_008746.5.
NP_877961.1. NM_182809.2.
UniGeneMm.33496.
Mm.421361.

3D structure databases

ProteinModelPortalQ6VNS1.
SMRQ6VNS1. Positions 28-428, 529-818.
ModBaseSearch...
MobiDBSearch...

Chemistry

ChEMBLCHEMBL2791.

PTM databases

PhosphoSiteQ6VNS1.

Proteomic databases

PaxDbQ6VNS1.
PRIDEQ6VNS1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000039431; ENSMUSP00000037909; ENSMUSG00000059146. [Q6VNS1-1]
ENSMUST00000039438; ENSMUSP00000038324; ENSMUSG00000059146. [Q6VNS1-3]
GeneID18213.
KEGGmmu:18213.
UCSCuc009hxf.2. mouse. [Q6VNS1-1]
uc009hxh.2. mouse. [Q6VNS1-3]
uc009hxi.2. mouse. [Q6VNS1-2]

Organism-specific databases

CTD4916.
MGIMGI:97385. Ntrk3.

Phylogenomic databases

eggNOGCOG0515.
GeneTreeENSGT00730000110657.
HOGENOMHOG000264255.
HOVERGENHBG056735.
InParanoidQ6VNS1.
KOK05101.
OMANFVSIYE.
OrthoDBEOG7GTT32.
PhylomeDBQ6VNS1.
TreeFamTF106465.

Gene expression databases

ArrayExpressQ6VNS1.
BgeeQ6VNS1.
CleanExMM_NTRK3.
GenevestigatorQ6VNS1.

Family and domain databases

Gene3D2.60.40.10. 2 hits.
InterProIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR001611. Leu-rich_rpt.
IPR000372. LRR-contain_N.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamPF07679. I-set. 2 hits.
PF01462. LRRNT. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMSSF56112. SSF56112. 1 hit.
PROSITEPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio293614.
PROQ6VNS1.
SOURCESearch...

Entry information

Entry nameNTRK3_MOUSE
AccessionPrimary (citable) accession number: Q6VNS1
Secondary accession number(s): A4QPD0, Q9Z2P9, Q9Z2Q0
Entry history
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot