Q6VNS1 (NTRK3_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 90.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NT-3 growth factor receptor EC=2.7.10.1 Alternative name(s): GP145-TrkC Short name=Trk-C Neurotrophic tyrosine kinase receptor type 3 TrkC tyrosine kinase | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 825 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the Trk receptors are SHC1, PI 3-kinase, and PLC-gamma-1 By similarity. |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. |
| Subunit structure | Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. Binds SH2B2. Interacts with SQSTM1 and KIDINS220 By similarity. |
| Subcellular location | Membrane; Single-pass type I membrane protein By similarity. |
| Tissue specificity | Isoform 2 expression is restricted to specific areas in adult brain. Isoform 3 transcripts are readily detected early during embryogenesis and are expressed predominantly in adult brain and gonads. Ref.2 |
| Post-translational modification | Ligand-mediated auto-phosphorylation By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily. Contains 2 Ig-like C2-type (immunoglobulin-like) domains. Contains 2 LRR (leucine-rich) repeats. Contains 1 LRRCT domain. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6VNS1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6VNS1-2) Also known as: TrkC NC1; The sequence of this isoform differs from the canonical sequence as follows: 467-502: PVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVV → KVLFFQSQEFHGFHLLIKRYCTSICSLRKPLVTGPW 503-825: Missing. | ||||||
| Note: Non-catalytic. | ||||||
| Isoform 3 (identifier: Q6VNS1-3) Also known as: TrkC NC2; The sequence of this isoform differs from the canonical sequence as follows: 529-612: YVQHIKRRDI...FYGVCGDGDP → WVFSNIDNHG...VYFSKGRHGF 613-825: Missing. | ||||||
| Note: Non-catalytic. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | By similarity | ||||||||
| Chain | 32 – 825 | 794 | NT-3 growth factor receptor | PRO_0000260434 | |||||||
Regions | |||||||||||
| Topological domain | 32 – 429 | 398 | Extracellular Potential | ||||||||
| Transmembrane | 430 – 453 | 24 | Helical; Potential | ||||||||
| Topological domain | 454 – 825 | 372 | Cytoplasmic Potential | ||||||||
| Repeat | 104 – 125 | 22 | LRR 1 | ||||||||
| Repeat | 128 – 149 | 22 | LRR 2 | ||||||||
| Domain | 160 – 209 | 50 | LRRCT | ||||||||
| Domain | 210 – 300 | 91 | Ig-like C2-type 1 | ||||||||
| Domain | 309 – 382 | 74 | Ig-like C2-type 2 | ||||||||
| Domain | 538 – 825 | 288 | Protein kinase | ||||||||
| Nucleotide binding | 544 – 552 | 9 | ATP By similarity | ||||||||
Sites | |||||||||||
| Active site | 679 | 1 | Proton acceptor By similarity | ||||||||
| Binding site | 572 | 1 | ATP By similarity | ||||||||
| Site | 516 | 1 | Interaction with SHC1 By similarity | ||||||||
| Site | 820 | 1 | Interaction with PLC-gamma-1 By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 516 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 705 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 709 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 710 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Glycosylation | 68 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 72 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 79 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 133 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 163 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 203 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 218 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 232 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 259 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 267 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 272 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 294 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 375 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 388 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 320 ↔ 362 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 467 – 502 | 36 | PVAVI…PDTVV → KVLFFQSQEFHGFHLLIKRY CTSICSLRKPLVTGPW in isoform 2. | VSP_021596 | |||||||
| Alternative sequence | 503 – 825 | 323 | Missing in isoform 2. | VSP_021597 | |||||||
| Alternative sequence | 529 – 612 | 84 | YVQHI…GDGDP → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGFREIMLNPISLSGH SKPLNHGIYVEDVNVYFSKG RHGF in isoform 3. | VSP_021598 | |||||||
| Alternative sequence | 613 – 825 | 213 | Missing in isoform 3. | VSP_021599 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 366 | 1 | N → K in AAC72289. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Neurotrophin 3 activation of TrkC induces Schwann cell migration through the c-Jun N-terminal kinase pathway." Yamauchi J., Chan J.R., Shooter E.M. Proc. Natl. Acad. Sci. U.S.A. 100:14421-14426(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: BALB/c. |
| [2] | "Differential expression of TrkC catalytic and noncatalytic isoforms suggests that they act independently or in association." Menn B., Timsit S., Calothy G., Lamballe F. J. Comp. Neurol. 401:47-64(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY. Strain: C57BL/6. Tissue: Brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [4] | "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain." Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P. J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-516; TYR-705; TYR-709 AND TYR-710, MASS SPECTROMETRY. Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY336094 mRNA. Translation: AAP94280.1. AF035399 mRNA. Translation: AAC72289.1. AF035400 mRNA. Translation: AAC72290.1. BC139764 mRNA. Translation: AAI39765.1. |
| IPI | IPI00131278. IPI00380220. IPI00807839. |
| RefSeq | NP_032772.3. NM_008746.5. NP_877961.1. NM_182809.2. |
| UniGene | Mm.33496. Mm.421361. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1WWC based on UniProtKB Q16288. |
| ProteinModelPortal | Q6VNS1. |
| SMR | Q6VNS1. Positions 28-428, 529-818. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q6VNS1. |
Proteomic databases | |
| PaxDb | Q6VNS1. |
| PRIDE | Q6VNS1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000039431; ENSMUSP00000037909; ENSMUSG00000059146. ENSMUST00000039438; ENSMUSP00000038324; ENSMUSG00000059146. |
| GeneID | 18213. |
| KEGG | mmu:18213. |
| UCSC | uc009hxf.2. mouse. uc009hxh.2. mouse. uc009hxi.2. mouse. |
Organism-specific databases | |
| CTD | 4916. |
| MGI | MGI:97385. Ntrk3. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| GeneTree | ENSGT00700000104172. |
| HOGENOM | HOG000264255. |
| HOVERGEN | HBG056735. |
| InParanoid | Q6VNS1. |
| KO | K05101. |
| OMA | NFVSIYE. |
| OrthoDB | EOG4W3SM8. |
Gene expression databases | |
| ArrayExpress | Q6VNS1. |
| Bgee | Q6VNS1. |
| CleanEx | MM_NTRK3. |
| Genevestigator | Q6VNS1. |
| GermOnline | ENSMUSG00000059146. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 2 hits. |
| InterPro | IPR000483. Cys-rich_flank_reg_C. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR011009. Kinase-like_dom. IPR001611. Leu-rich_rpt. IPR000372. LRR-contain_N. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR020446. Tyr_kin_neurotrophic_rcpt_3. IPR008266. Tyr_kinase_AS. IPR020635. Tyr_kinase_cat_dom. IPR020777. Tyr_kinase_NGF_rcpt. IPR002011. Tyr_kinase_rcpt_2_CS. [Graphical view] |
| Pfam | PF07679. I-set. 2 hits. PF01462. LRRNT. 1 hit. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] |
| PRINTS | PR01939. NTKRECEPTOR. PR01942. NTKRECEPTOR3. PR00109. TYRKINASE. |
| SMART | SM00409. IG. 1 hit. SM00082. LRRCT. 1 hit. SM00013. LRRNT. 1 hit. SM00219. TyrKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS50835. IG_LIKE. 1 hit. PS51450. LRR. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. PS00239. RECEPTOR_TYR_KIN_II. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL2791. |
| NextBio | 293614. |
| SOURCE | Search... |
Entry information
| Entry name | NTRK3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q6VNS1 Secondary accession number(s): A4QPD0, Q9Z2P9, Q9Z2Q0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
