SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6VNS1

- NTRK3_MOUSE

UniProt

Q6VNS1 - NTRK3_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
NT-3 growth factor receptor
Gene
Ntrk3, TrkC
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the Trk receptors are SHC1, PI 3-kinase, and PLC-gamma-1 By similarity.

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei516 – 5161Interaction with SHC1 By similarity
Binding sitei572 – 5721ATP By similarity
Active sitei679 – 6791Proton acceptor By similarity
Sitei820 – 8201Interaction with PLC-gamma-1 By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi544 – 5529ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. neurotrophin receptor activity Source: Ensembl
  3. protein binding Source: MGI
  4. transmembrane receptor protein tyrosine kinase activity Source: UniProtKB-EC

GO - Biological processi

  1. activation of MAPK activity Source: Ensembl
  2. activation of Ras GTPase activity Source: Ensembl
  3. activation of protein kinase B activity Source: Ensembl
  4. cellular response to retinoic acid Source: Ensembl
  5. circadian rhythm Source: UniProtKB
  6. cochlea development Source: Ensembl
  7. lens fiber cell differentiation Source: MGI
  8. mechanoreceptor differentiation Source: MGI
  9. modulation by virus of host transcription Source: Ensembl
  10. negative regulation of astrocyte differentiation Source: Ensembl
  11. negative regulation of cell death Source: Ensembl
  12. negative regulation of protein phosphorylation Source: Ensembl
  13. neuron fate specification Source: Ensembl
  14. neuron migration Source: Ensembl
  15. positive regulation of actin cytoskeleton reorganization Source: Ensembl
  16. positive regulation of axon extension involved in regeneration Source: MGI
  17. positive regulation of cell migration Source: Ensembl
  18. positive regulation of cell proliferation Source: Ensembl
  19. positive regulation of gene expression Source: Ensembl
  20. positive regulation of peptidyl-serine phosphorylation Source: Ensembl
  21. positive regulation of positive chemotaxis Source: Ensembl
  22. protein autophosphorylation Source: Ensembl
  23. response to axon injury Source: Ensembl
  24. response to corticosterone Source: Ensembl
  25. response to ethanol Source: Ensembl
  26. transmembrane receptor protein tyrosine kinase signaling pathway Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Differentiation, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
NT-3 growth factor receptor (EC:2.7.10.1)
Alternative name(s):
GP145-TrkC
Short name:
Trk-C
Neurotrophic tyrosine kinase receptor type 3
TrkC tyrosine kinase
Gene namesi
Name:Ntrk3
Synonyms:TrkC
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 7

Organism-specific databases

MGIiMGI:97385. Ntrk3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini32 – 429398Extracellular Reviewed prediction
Add
BLAST
Transmembranei430 – 45324Helical; Reviewed prediction
Add
BLAST
Topological domaini454 – 825372Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. integral component of plasma membrane Source: InterPro
  3. receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131 By similarity
Add
BLAST
Chaini32 – 825794NT-3 growth factor receptor
PRO_0000260434Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi68 – 681N-linked (GlcNAc...) Reviewed prediction
Glycosylationi72 – 721N-linked (GlcNAc...) Reviewed prediction
Glycosylationi79 – 791N-linked (GlcNAc...) Reviewed prediction
Glycosylationi133 – 1331N-linked (GlcNAc...) Reviewed prediction
Glycosylationi163 – 1631N-linked (GlcNAc...) Reviewed prediction
Glycosylationi203 – 2031N-linked (GlcNAc...) Reviewed prediction
Glycosylationi218 – 2181N-linked (GlcNAc...) Reviewed prediction
Glycosylationi232 – 2321N-linked (GlcNAc...) Reviewed prediction
Glycosylationi259 – 2591N-linked (GlcNAc...) Reviewed prediction
Glycosylationi267 – 2671N-linked (GlcNAc...) Reviewed prediction
Glycosylationi272 – 2721N-linked (GlcNAc...) Reviewed prediction
Glycosylationi294 – 2941N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi320 ↔ 362 By similarity
Glycosylationi375 – 3751N-linked (GlcNAc...) Reviewed prediction
Glycosylationi388 – 3881N-linked (GlcNAc...) Reviewed prediction
Modified residuei516 – 5161Phosphotyrosine; alternate1 Publication
Modified residuei516 – 5161Phosphotyrosine; by autocatalysis; alternate By similarity
Modified residuei705 – 7051Phosphotyrosine; by autocatalysis By similarity
Modified residuei709 – 7091Phosphotyrosine; by autocatalysis By similarity
Modified residuei710 – 7101Phosphotyrosine; by autocatalysis By similarity

Post-translational modificationi

Ligand-mediated auto-phosphorylation By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ6VNS1.
PRIDEiQ6VNS1.

PTM databases

PhosphoSiteiQ6VNS1.

Expressioni

Tissue specificityi

Isoform 2 expression is restricted to specific areas in adult brain. Isoform 3 transcripts are readily detected early during embryogenesis and are expressed predominantly in adult brain and gonads.1 Publication

Inductioni

Expression oscillates in a circadian manner in the liver.1 Publication

Gene expression databases

ArrayExpressiQ6VNS1.
BgeeiQ6VNS1.
CleanExiMM_NTRK3.
GenevestigatoriQ6VNS1.

Interactioni

Subunit structurei

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. Binds SH2B2. Interacts with SQSTM1 and KIDINS220 By similarity.

Structurei

3D structure databases

ProteinModelPortaliQ6VNS1.
SMRiQ6VNS1. Positions 28-428, 529-818.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati104 – 12522LRR 1
Add
BLAST
Repeati128 – 14922LRR 2
Add
BLAST
Domaini160 – 20950LRRCT
Add
BLAST
Domaini210 – 30091Ig-like C2-type 1
Add
BLAST
Domaini309 – 38274Ig-like C2-type 2
Add
BLAST
Domaini538 – 825288Protein kinase
Add
BLAST

Sequence similaritiesi

Contains 1 LRRCT domain.

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00730000110657.
HOGENOMiHOG000264255.
HOVERGENiHBG056735.
InParanoidiQ6VNS1.
KOiK05101.
OMAiNFVSIYE.
OrthoDBiEOG7GTT32.
PhylomeDBiQ6VNS1.
TreeFamiTF106465.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR001611. Leu-rich_rpt.
IPR000372. LRR-contain_N.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF01462. LRRNT. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6VNS1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDVSLCPAKC SFWRIFLLGS VWLDYVGSVL ACPANCVCSK TEINCRRPDD    50
GNLFPLLEGQ DSGNSNGNAS INITDISRNI TSIHIENWRG LHTLNAVDME 100
LYTGLQKLTI KNSGLRNIQP RAFAKNPHLR YINLSSNRLT TLSWQLFQTL 150
SLRELRLEQN FFNCSCDIRW MQLWQEQGEA RLDSQSLYCI SADGSQLPLF 200
RMNISQCDLP EISVSHVNLT VREGDNAVIT CNGSGSPLPD VDWIVTGLQS 250
INTHQTNLNW TNVHAINLTL VNVTSEDNGF TLTCIAENVV GMSNASVALT 300
VYYPPRVVSL VEPEVRLEHC IEFVVRGNPT PTLHWLYNGQ PLRESKIIHM 350
DYYQEGEVSE GCLLFNKPTH YNNGNYTLIA KNALGTANQT INGHFLKEPF 400
PESTDFFDFE SDASPTPPIT VTHKPEEDTF GVSIAVGLAA FACVLLVVLF 450
IMINKYGRRS KFGMKGPVAV ISGEEDSASP LHHINHGITT PSSLDAGPDT 500
VVIGMTRIPV IENPQYFRQG HNCHKPDTYV QHIKRRDIVL KRELGEGAFG 550
KVFLAECYNL SPTKDKMLVA VKALKDPTLA ARKDFQREAE LLTNLQHEHI 600
VKFYGVCGDG DPLIMVFEYM KHGDLNKFLR AHGPDAMILV DGQPRQAKGE 650
LGLSQMLHIA SQIASGMVYL ASQHFVHRDL ATRNCLVGAN LLVKIGDFGM 700
SRDVYSTDYY RVGGHTMLPI RWMPPESIMY RKFTTESDVW SFGVILWEIF 750
TYGKQPWFQL SNTEVIECIT QGRVLERPRV CPKEVYDVML GCWQREPQQR 800
LNIKEIYKIL HALGKATPIY LDILG 825
Length:825
Mass (Da):92,760
Last modified:July 5, 2004 - v1
Checksum:i4DE08AB546CC5BD6
GO
Isoform 2 (identifier: Q6VNS1-2) [UniParc]FASTAAdd to Basket

Also known as: TrkC NC1

The sequence of this isoform differs from the canonical sequence as follows:
     467-502: PVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVV → KVLFFQSQEFHGFHLLIKRYCTSICSLRKPLVTGPW
     503-825: Missing.

Note: Non-catalytic.

Show »
Length:502
Mass (Da):56,352
Checksum:i535D9ED9D7AF50CC
GO
Isoform 3 (identifier: Q6VNS1-3) [UniParc]FASTAAdd to Basket

Also known as: TrkC NC2

The sequence of this isoform differs from the canonical sequence as follows:
     529-612: YVQHIKRRDI...FYGVCGDGDP → WVFSNIDNHG...VYFSKGRHGF
     613-825: Missing.

Note: Non-catalytic.

Show »
Length:612
Mass (Da):68,387
Checksum:i376F0F449792CE46
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei467 – 50236PVAVI…PDTVV → KVLFFQSQEFHGFHLLIKRY CTSICSLRKPLVTGPW in isoform 2.
VSP_021596Add
BLAST
Alternative sequencei503 – 825323Missing in isoform 2.
VSP_021597Add
BLAST
Alternative sequencei529 – 61284YVQHI…GDGDP → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGFREIMLNPISLSGH SKPLNHGIYVEDVNVYFSKG RHGF in isoform 3.
VSP_021598Add
BLAST
Alternative sequencei613 – 825213Missing in isoform 3.
VSP_021599Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti366 – 3661N → K in AAC72289. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY336094 mRNA. Translation: AAP94280.1.
AF035399 mRNA. Translation: AAC72289.1.
AF035400 mRNA. Translation: AAC72290.1.
BC139764 mRNA. Translation: AAI39765.1.
CCDSiCCDS21371.1. [Q6VNS1-1]
CCDS21372.1. [Q6VNS1-3]
RefSeqiNP_032772.3. NM_008746.5. [Q6VNS1-1]
NP_877961.1. NM_182809.2. [Q6VNS1-3]
UniGeneiMm.33496.
Mm.421361.

Genome annotation databases

EnsembliENSMUST00000039431; ENSMUSP00000037909; ENSMUSG00000059146. [Q6VNS1-1]
ENSMUST00000039438; ENSMUSP00000038324; ENSMUSG00000059146. [Q6VNS1-3]
GeneIDi18213.
KEGGimmu:18213.
UCSCiuc009hxf.2. mouse. [Q6VNS1-1]
uc009hxh.2. mouse. [Q6VNS1-3]
uc009hxi.2. mouse. [Q6VNS1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY336094 mRNA. Translation: AAP94280.1 .
AF035399 mRNA. Translation: AAC72289.1 .
AF035400 mRNA. Translation: AAC72290.1 .
BC139764 mRNA. Translation: AAI39765.1 .
CCDSi CCDS21371.1. [Q6VNS1-1 ]
CCDS21372.1. [Q6VNS1-3 ]
RefSeqi NP_032772.3. NM_008746.5. [Q6VNS1-1 ]
NP_877961.1. NM_182809.2. [Q6VNS1-3 ]
UniGenei Mm.33496.
Mm.421361.

3D structure databases

ProteinModelPortali Q6VNS1.
SMRi Q6VNS1. Positions 28-428, 529-818.
ModBasei Search...
MobiDBi Search...

Chemistry

ChEMBLi CHEMBL2791.

PTM databases

PhosphoSitei Q6VNS1.

Proteomic databases

PaxDbi Q6VNS1.
PRIDEi Q6VNS1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000039431 ; ENSMUSP00000037909 ; ENSMUSG00000059146 . [Q6VNS1-1 ]
ENSMUST00000039438 ; ENSMUSP00000038324 ; ENSMUSG00000059146 . [Q6VNS1-3 ]
GeneIDi 18213.
KEGGi mmu:18213.
UCSCi uc009hxf.2. mouse. [Q6VNS1-1 ]
uc009hxh.2. mouse. [Q6VNS1-3 ]
uc009hxi.2. mouse. [Q6VNS1-2 ]

Organism-specific databases

CTDi 4916.
MGIi MGI:97385. Ntrk3.

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00730000110657.
HOGENOMi HOG000264255.
HOVERGENi HBG056735.
InParanoidi Q6VNS1.
KOi K05101.
OMAi NFVSIYE.
OrthoDBi EOG7GTT32.
PhylomeDBi Q6VNS1.
TreeFami TF106465.

Miscellaneous databases

NextBioi 293614.
PROi Q6VNS1.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q6VNS1.
Bgeei Q6VNS1.
CleanExi MM_NTRK3.
Genevestigatori Q6VNS1.

Family and domain databases

Gene3Di 2.60.40.10. 2 hits.
InterProi IPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR001611. Leu-rich_rpt.
IPR000372. LRR-contain_N.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view ]
Pfami PF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF01462. LRRNT. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view ]
PRINTSi PR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTi SM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Neurotrophin 3 activation of TrkC induces Schwann cell migration through the c-Jun N-terminal kinase pathway."
    Yamauchi J., Chan J.R., Shooter E.M.
    Proc. Natl. Acad. Sci. U.S.A. 100:14421-14426(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: BALB/c.
  2. "Differential expression of TrkC catalytic and noncatalytic isoforms suggests that they act independently or in association."
    Menn B., Timsit S., Calothy G., Lamballe F.
    J. Comp. Neurol. 401:47-64(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY.
    Strain: C57BL/6.
    Tissue: Brain.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  4. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
    Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
    J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-516, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  5. "p75 neurotrophin receptor is a clock gene that regulates oscillatory components of circadian and metabolic networks."
    Baeza-Raja B., Eckel-Mahan K., Zhang L., Vagena E., Tsigelny I.F., Sassone-Corsi P., Ptacek L.J., Akassoglou K.
    J. Neurosci. 33:10221-10234(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.

Entry informationi

Entry nameiNTRK3_MOUSE
AccessioniPrimary (citable) accession number: Q6VNS1
Secondary accession number(s): A4QPD0, Q9Z2P9, Q9Z2Q0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: July 5, 2004
Last modified: July 9, 2014
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi