Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NT-3 growth factor receptor

Gene

Ntrk3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the Trk receptors are SHC1, PI 3-kinase, and PLC-gamma-1 (By similarity).By similarity

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei516 – 5161Interaction with SHC1By similarity
Binding sitei572 – 5721ATPPROSITE-ProRule annotation
Active sitei679 – 6791Proton acceptorPROSITE-ProRule annotation
Sitei820 – 8201Interaction with PLC-gamma-1By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi544 – 5529ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. neurotrophin receptor activity Source: MGI
  3. p53 binding Source: MGI
  4. transmembrane receptor protein tyrosine kinase activity Source: UniProtKB-EC

GO - Biological processi

  1. activation of MAPK activity Source: MGI
  2. activation of protein kinase B activity Source: MGI
  3. activation of Ras GTPase activity Source: MGI
  4. cellular response to retinoic acid Source: Ensembl
  5. circadian rhythm Source: UniProtKB
  6. cochlea development Source: Ensembl
  7. lens fiber cell differentiation Source: MGI
  8. mechanoreceptor differentiation Source: MGI
  9. modulation by virus of host transcription Source: Ensembl
  10. negative regulation of astrocyte differentiation Source: Ensembl
  11. negative regulation of cell death Source: Ensembl
  12. negative regulation of protein phosphorylation Source: MGI
  13. neuron fate specification Source: Ensembl
  14. neuron migration Source: Ensembl
  15. neurotrophin signaling pathway Source: MGI
  16. positive regulation of actin cytoskeleton reorganization Source: MGI
  17. positive regulation of axon extension involved in regeneration Source: MGI
  18. positive regulation of cell migration Source: MGI
  19. positive regulation of cell proliferation Source: MGI
  20. positive regulation of gene expression Source: MGI
  21. positive regulation of peptidyl-serine phosphorylation Source: MGI
  22. positive regulation of positive chemotaxis Source: MGI
  23. protein autophosphorylation Source: Ensembl
  24. response to axon injury Source: Ensembl
  25. response to corticosterone Source: Ensembl
  26. response to ethanol Source: Ensembl
  27. transmembrane receptor protein tyrosine kinase signaling pathway Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Differentiation, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
NT-3 growth factor receptor (EC:2.7.10.1)
Alternative name(s):
GP145-TrkC
Short name:
Trk-C
Neurotrophic tyrosine kinase receptor type 3
TrkC tyrosine kinase
Gene namesi
Name:Ntrk3
Synonyms:TrkC
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 7

Organism-specific databases

MGIiMGI:97385. Ntrk3.

Subcellular locationi

Membrane By similarity; Single-pass type I membrane protein By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini32 – 429398ExtracellularSequence AnalysisAdd
BLAST
Transmembranei430 – 45324HelicalSequence AnalysisAdd
BLAST
Topological domaini454 – 825372CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. integral component of plasma membrane Source: InterPro
  3. receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131By similarityAdd
BLAST
Chaini32 – 825794NT-3 growth factor receptorPRO_0000260434Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi68 – 681N-linked (GlcNAc...)Sequence Analysis
Glycosylationi72 – 721N-linked (GlcNAc...)Sequence Analysis
Glycosylationi79 – 791N-linked (GlcNAc...)Sequence Analysis
Glycosylationi133 – 1331N-linked (GlcNAc...)Sequence Analysis
Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence Analysis
Glycosylationi203 – 2031N-linked (GlcNAc...)Sequence Analysis
Glycosylationi218 – 2181N-linked (GlcNAc...)Sequence Analysis
Glycosylationi232 – 2321N-linked (GlcNAc...)Sequence Analysis
Glycosylationi259 – 2591N-linked (GlcNAc...)Sequence Analysis
Glycosylationi267 – 2671N-linked (GlcNAc...)Sequence Analysis
Glycosylationi272 – 2721N-linked (GlcNAc...)Sequence Analysis
Glycosylationi294 – 2941N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi320 ↔ 362PROSITE-ProRule annotation
Glycosylationi375 – 3751N-linked (GlcNAc...)Sequence Analysis
Glycosylationi388 – 3881N-linked (GlcNAc...)Sequence Analysis
Modified residuei516 – 5161Phosphotyrosine; alternate1 Publication
Modified residuei516 – 5161Phosphotyrosine; by autocatalysis; alternateBy similarity
Modified residuei705 – 7051Phosphotyrosine; by autocatalysisBy similarity
Modified residuei709 – 7091Phosphotyrosine; by autocatalysisBy similarity
Modified residuei710 – 7101Phosphotyrosine; by autocatalysisBy similarity

Post-translational modificationi

Ligand-mediated auto-phosphorylation.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ6VNS1.
PaxDbiQ6VNS1.
PRIDEiQ6VNS1.

PTM databases

PhosphoSiteiQ6VNS1.

Expressioni

Tissue specificityi

Isoform 2 expression is restricted to specific areas in adult brain. Isoform 3 transcripts are readily detected early during embryogenesis and are expressed predominantly in adult brain and gonads.1 Publication

Inductioni

Expression oscillates in a circadian manner in the liver.1 Publication

Gene expression databases

BgeeiQ6VNS1.
CleanExiMM_NTRK3.
ExpressionAtlasiQ6VNS1. baseline and differential.
GenevestigatoriQ6VNS1.

Interactioni

Subunit structurei

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. Binds SH2B2. Interacts with SQSTM1 and KIDINS220 (By similarity).By similarity

Structurei

3D structure databases

ProteinModelPortaliQ6VNS1.
SMRiQ6VNS1. Positions 28-428, 529-818.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati104 – 12522LRR 1Add
BLAST
Repeati128 – 14922LRR 2Add
BLAST
Domaini160 – 20950LRRCTAdd
BLAST
Domaini210 – 30091Ig-like C2-type 1Add
BLAST
Domaini309 – 38274Ig-like C2-type 2Add
BLAST
Domaini538 – 825288Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
Contains 2 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000264255.
HOVERGENiHBG056735.
InParanoidiQ6VNS1.
KOiK05101.
OMAiNFVSIYE.
OrthoDBiEOG7GTT32.
PhylomeDBiQ6VNS1.
TreeFamiTF106465.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR001611. Leu-rich_rpt.
IPR000372. LRR-contain_N.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF01462. LRRNT. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6VNS1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVSLCPAKC SFWRIFLLGS VWLDYVGSVL ACPANCVCSK TEINCRRPDD
60 70 80 90 100
GNLFPLLEGQ DSGNSNGNAS INITDISRNI TSIHIENWRG LHTLNAVDME
110 120 130 140 150
LYTGLQKLTI KNSGLRNIQP RAFAKNPHLR YINLSSNRLT TLSWQLFQTL
160 170 180 190 200
SLRELRLEQN FFNCSCDIRW MQLWQEQGEA RLDSQSLYCI SADGSQLPLF
210 220 230 240 250
RMNISQCDLP EISVSHVNLT VREGDNAVIT CNGSGSPLPD VDWIVTGLQS
260 270 280 290 300
INTHQTNLNW TNVHAINLTL VNVTSEDNGF TLTCIAENVV GMSNASVALT
310 320 330 340 350
VYYPPRVVSL VEPEVRLEHC IEFVVRGNPT PTLHWLYNGQ PLRESKIIHM
360 370 380 390 400
DYYQEGEVSE GCLLFNKPTH YNNGNYTLIA KNALGTANQT INGHFLKEPF
410 420 430 440 450
PESTDFFDFE SDASPTPPIT VTHKPEEDTF GVSIAVGLAA FACVLLVVLF
460 470 480 490 500
IMINKYGRRS KFGMKGPVAV ISGEEDSASP LHHINHGITT PSSLDAGPDT
510 520 530 540 550
VVIGMTRIPV IENPQYFRQG HNCHKPDTYV QHIKRRDIVL KRELGEGAFG
560 570 580 590 600
KVFLAECYNL SPTKDKMLVA VKALKDPTLA ARKDFQREAE LLTNLQHEHI
610 620 630 640 650
VKFYGVCGDG DPLIMVFEYM KHGDLNKFLR AHGPDAMILV DGQPRQAKGE
660 670 680 690 700
LGLSQMLHIA SQIASGMVYL ASQHFVHRDL ATRNCLVGAN LLVKIGDFGM
710 720 730 740 750
SRDVYSTDYY RVGGHTMLPI RWMPPESIMY RKFTTESDVW SFGVILWEIF
760 770 780 790 800
TYGKQPWFQL SNTEVIECIT QGRVLERPRV CPKEVYDVML GCWQREPQQR
810 820
LNIKEIYKIL HALGKATPIY LDILG
Length:825
Mass (Da):92,760
Last modified:July 5, 2004 - v1
Checksum:i4DE08AB546CC5BD6
GO
Isoform 2 (identifier: Q6VNS1-2) [UniParc]FASTAAdd to Basket

Also known as: TrkC NC1

The sequence of this isoform differs from the canonical sequence as follows:
     467-502: PVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVV → KVLFFQSQEFHGFHLLIKRYCTSICSLRKPLVTGPW
     503-825: Missing.

Note: Non-catalytic.

Show »
Length:502
Mass (Da):56,352
Checksum:i535D9ED9D7AF50CC
GO
Isoform 3 (identifier: Q6VNS1-3) [UniParc]FASTAAdd to Basket

Also known as: TrkC NC2

The sequence of this isoform differs from the canonical sequence as follows:
     529-612: YVQHIKRRDI...FYGVCGDGDP → WVFSNIDNHG...VYFSKGRHGF
     613-825: Missing.

Note: Non-catalytic.

Show »
Length:612
Mass (Da):68,387
Checksum:i376F0F449792CE46
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti366 – 3661N → K in AAC72289. (PubMed:9802700)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei467 – 50236PVAVI…PDTVV → KVLFFQSQEFHGFHLLIKRY CTSICSLRKPLVTGPW in isoform 2. 1 PublicationVSP_021596Add
BLAST
Alternative sequencei503 – 825323Missing in isoform 2. 1 PublicationVSP_021597Add
BLAST
Alternative sequencei529 – 61284YVQHI…GDGDP → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGFREIMLNPISLSGH SKPLNHGIYVEDVNVYFSKG RHGF in isoform 3. 2 PublicationsVSP_021598Add
BLAST
Alternative sequencei613 – 825213Missing in isoform 3. 2 PublicationsVSP_021599Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY336094 mRNA. Translation: AAP94280.1.
AF035399 mRNA. Translation: AAC72289.1.
AF035400 mRNA. Translation: AAC72290.1.
BC139764 mRNA. Translation: AAI39765.1.
CCDSiCCDS21371.1. [Q6VNS1-1]
CCDS21372.1. [Q6VNS1-3]
RefSeqiNP_032772.3. NM_008746.5. [Q6VNS1-1]
NP_877961.1. NM_182809.2. [Q6VNS1-3]
UniGeneiMm.33496.
Mm.421361.

Genome annotation databases

EnsembliENSMUST00000039431; ENSMUSP00000037909; ENSMUSG00000059146. [Q6VNS1-1]
ENSMUST00000039438; ENSMUSP00000038324; ENSMUSG00000059146. [Q6VNS1-3]
GeneIDi18213.
KEGGimmu:18213.
UCSCiuc009hxf.2. mouse. [Q6VNS1-1]
uc009hxh.2. mouse. [Q6VNS1-3]
uc009hxi.2. mouse. [Q6VNS1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY336094 mRNA. Translation: AAP94280.1.
AF035399 mRNA. Translation: AAC72289.1.
AF035400 mRNA. Translation: AAC72290.1.
BC139764 mRNA. Translation: AAI39765.1.
CCDSiCCDS21371.1. [Q6VNS1-1]
CCDS21372.1. [Q6VNS1-3]
RefSeqiNP_032772.3. NM_008746.5. [Q6VNS1-1]
NP_877961.1. NM_182809.2. [Q6VNS1-3]
UniGeneiMm.33496.
Mm.421361.

3D structure databases

ProteinModelPortaliQ6VNS1.
SMRiQ6VNS1. Positions 28-428, 529-818.
ModBaseiSearch...
MobiDBiSearch...

Chemistry

ChEMBLiCHEMBL2791.

Protein family/group databases

MEROPSiI43.001.

PTM databases

PhosphoSiteiQ6VNS1.

Proteomic databases

MaxQBiQ6VNS1.
PaxDbiQ6VNS1.
PRIDEiQ6VNS1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000039431; ENSMUSP00000037909; ENSMUSG00000059146. [Q6VNS1-1]
ENSMUST00000039438; ENSMUSP00000038324; ENSMUSG00000059146. [Q6VNS1-3]
GeneIDi18213.
KEGGimmu:18213.
UCSCiuc009hxf.2. mouse. [Q6VNS1-1]
uc009hxh.2. mouse. [Q6VNS1-3]
uc009hxi.2. mouse. [Q6VNS1-2]

Organism-specific databases

CTDi4916.
MGIiMGI:97385. Ntrk3.

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000264255.
HOVERGENiHBG056735.
InParanoidiQ6VNS1.
KOiK05101.
OMAiNFVSIYE.
OrthoDBiEOG7GTT32.
PhylomeDBiQ6VNS1.
TreeFamiTF106465.

Miscellaneous databases

ChiTaRSiNtrk3. mouse.
NextBioi293614.
PROiQ6VNS1.
SOURCEiSearch...

Gene expression databases

BgeeiQ6VNS1.
CleanExiMM_NTRK3.
ExpressionAtlasiQ6VNS1. baseline and differential.
GenevestigatoriQ6VNS1.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR001611. Leu-rich_rpt.
IPR000372. LRR-contain_N.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF01462. LRRNT. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Neurotrophin 3 activation of TrkC induces Schwann cell migration through the c-Jun N-terminal kinase pathway."
    Yamauchi J., Chan J.R., Shooter E.M.
    Proc. Natl. Acad. Sci. U.S.A. 100:14421-14426(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: BALB/c.
  2. "Differential expression of TrkC catalytic and noncatalytic isoforms suggests that they act independently or in association."
    Menn B., Timsit S., Calothy G., Lamballe F.
    J. Comp. Neurol. 401:47-64(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY.
    Strain: C57BL/6.
    Tissue: Brain.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  4. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
    Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
    J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-516, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  5. "p75 neurotrophin receptor is a clock gene that regulates oscillatory components of circadian and metabolic networks."
    Baeza-Raja B., Eckel-Mahan K., Zhang L., Vagena E., Tsigelny I.F., Sassone-Corsi P., Ptacek L.J., Akassoglou K.
    J. Neurosci. 33:10221-10234(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.

Entry informationi

Entry nameiNTRK3_MOUSE
AccessioniPrimary (citable) accession number: Q6VNS1
Secondary accession number(s): A4QPD0, Q9Z2P9, Q9Z2Q0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: July 5, 2004
Last modified: February 4, 2015
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.