Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6VNS1

- NTRK3_MOUSE

UniProt

Q6VNS1 - NTRK3_MOUSE

Protein

NT-3 growth factor receptor

Gene

Ntrk3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the Trk receptors are SHC1, PI 3-kinase, and PLC-gamma-1 By similarity.By similarity

    Catalytic activityi

    ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei516 – 5161Interaction with SHC1By similarity
    Binding sitei572 – 5721ATPPROSITE-ProRule annotation
    Active sitei679 – 6791Proton acceptorPROSITE-ProRule annotation
    Sitei820 – 8201Interaction with PLC-gamma-1By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi544 – 5529ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. neurotrophin receptor activity Source: Ensembl
    3. protein binding Source: MGI
    4. transmembrane receptor protein tyrosine kinase activity Source: UniProtKB-EC

    GO - Biological processi

    1. activation of MAPK activity Source: Ensembl
    2. activation of protein kinase B activity Source: Ensembl
    3. activation of Ras GTPase activity Source: Ensembl
    4. cellular response to retinoic acid Source: Ensembl
    5. circadian rhythm Source: UniProtKB
    6. cochlea development Source: Ensembl
    7. lens fiber cell differentiation Source: MGI
    8. mechanoreceptor differentiation Source: MGI
    9. modulation by virus of host transcription Source: Ensembl
    10. negative regulation of astrocyte differentiation Source: Ensembl
    11. negative regulation of cell death Source: Ensembl
    12. negative regulation of protein phosphorylation Source: Ensembl
    13. neuron fate specification Source: Ensembl
    14. neuron migration Source: Ensembl
    15. positive regulation of actin cytoskeleton reorganization Source: Ensembl
    16. positive regulation of axon extension involved in regeneration Source: MGI
    17. positive regulation of cell migration Source: Ensembl
    18. positive regulation of cell proliferation Source: Ensembl
    19. positive regulation of gene expression Source: Ensembl
    20. positive regulation of peptidyl-serine phosphorylation Source: Ensembl
    21. positive regulation of positive chemotaxis Source: Ensembl
    22. protein autophosphorylation Source: Ensembl
    23. response to axon injury Source: Ensembl
    24. response to corticosterone Source: Ensembl
    25. response to ethanol Source: Ensembl
    26. transmembrane receptor protein tyrosine kinase signaling pathway Source: Ensembl

    Keywords - Molecular functioni

    Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

    Keywords - Biological processi

    Differentiation, Neurogenesis

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    NT-3 growth factor receptor (EC:2.7.10.1)
    Alternative name(s):
    GP145-TrkC
    Short name:
    Trk-C
    Neurotrophic tyrosine kinase receptor type 3
    TrkC tyrosine kinase
    Gene namesi
    Name:Ntrk3
    Synonyms:TrkC
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 7

    Organism-specific databases

    MGIiMGI:97385. Ntrk3.

    Subcellular locationi

    Membrane By similarity; Single-pass type I membrane protein By similarity

    GO - Cellular componenti

    1. cytoplasm Source: MGI
    2. integral component of plasma membrane Source: InterPro
    3. receptor complex Source: MGI

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3131By similarityAdd
    BLAST
    Chaini32 – 825794NT-3 growth factor receptorPRO_0000260434Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi68 – 681N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi72 – 721N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi79 – 791N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi133 – 1331N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi203 – 2031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi218 – 2181N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi232 – 2321N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi259 – 2591N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi267 – 2671N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi272 – 2721N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi294 – 2941N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi320 ↔ 362PROSITE-ProRule annotation
    Glycosylationi375 – 3751N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi388 – 3881N-linked (GlcNAc...)Sequence Analysis
    Modified residuei516 – 5161Phosphotyrosine; alternate1 Publication
    Modified residuei516 – 5161Phosphotyrosine; by autocatalysis; alternateBy similarity
    Modified residuei705 – 7051Phosphotyrosine; by autocatalysisBy similarity
    Modified residuei709 – 7091Phosphotyrosine; by autocatalysisBy similarity
    Modified residuei710 – 7101Phosphotyrosine; by autocatalysisBy similarity

    Post-translational modificationi

    Ligand-mediated auto-phosphorylation.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ6VNS1.
    PRIDEiQ6VNS1.

    PTM databases

    PhosphoSiteiQ6VNS1.

    Expressioni

    Tissue specificityi

    Isoform 2 expression is restricted to specific areas in adult brain. Isoform 3 transcripts are readily detected early during embryogenesis and are expressed predominantly in adult brain and gonads.1 Publication

    Inductioni

    Expression oscillates in a circadian manner in the liver.1 Publication

    Gene expression databases

    ArrayExpressiQ6VNS1.
    BgeeiQ6VNS1.
    CleanExiMM_NTRK3.
    GenevestigatoriQ6VNS1.

    Interactioni

    Subunit structurei

    Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. Binds SH2B2. Interacts with SQSTM1 and KIDINS220 By similarity.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ6VNS1.
    SMRiQ6VNS1. Positions 28-428, 529-818.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini32 – 429398ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini454 – 825372CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei430 – 45324HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati104 – 12522LRR 1Add
    BLAST
    Repeati128 – 14922LRR 2Add
    BLAST
    Domaini160 – 20950LRRCTAdd
    BLAST
    Domaini210 – 30091Ig-like C2-type 1Add
    BLAST
    Domaini309 – 38274Ig-like C2-type 2Add
    BLAST
    Domaini538 – 825288Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
    Contains 2 LRR (leucine-rich) repeats.Curated
    Contains 1 LRRCT domain.Curated
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0515.
    GeneTreeiENSGT00730000110657.
    HOGENOMiHOG000264255.
    HOVERGENiHBG056735.
    InParanoidiQ6VNS1.
    KOiK05101.
    OMAiNFVSIYE.
    OrthoDBiEOG7GTT32.
    PhylomeDBiQ6VNS1.
    TreeFamiTF106465.

    Family and domain databases

    Gene3Di2.60.40.10. 2 hits.
    InterProiIPR000483. Cys-rich_flank_reg_C.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR011009. Kinase-like_dom.
    IPR001611. Leu-rich_rpt.
    IPR000372. LRR-contain_N.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR020446. Tyr_kin_neurotrophic_rcpt_3.
    IPR008266. Tyr_kinase_AS.
    IPR020635. Tyr_kinase_cat_dom.
    IPR020777. Tyr_kinase_NGF_rcpt.
    IPR002011. Tyr_kinase_rcpt_2_CS.
    [Graphical view]
    PfamiPF07679. I-set. 2 hits.
    PF13855. LRR_8. 1 hit.
    PF01462. LRRNT. 1 hit.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view]
    PRINTSiPR01939. NTKRECEPTOR.
    PR01942. NTKRECEPTOR3.
    PR00109. TYRKINASE.
    SMARTiSM00409. IG. 1 hit.
    SM00082. LRRCT. 1 hit.
    SM00013. LRRNT. 1 hit.
    SM00219. TyrKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS50835. IG_LIKE. 1 hit.
    PS51450. LRR. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00109. PROTEIN_KINASE_TYR. 1 hit.
    PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6VNS1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDVSLCPAKC SFWRIFLLGS VWLDYVGSVL ACPANCVCSK TEINCRRPDD    50
    GNLFPLLEGQ DSGNSNGNAS INITDISRNI TSIHIENWRG LHTLNAVDME 100
    LYTGLQKLTI KNSGLRNIQP RAFAKNPHLR YINLSSNRLT TLSWQLFQTL 150
    SLRELRLEQN FFNCSCDIRW MQLWQEQGEA RLDSQSLYCI SADGSQLPLF 200
    RMNISQCDLP EISVSHVNLT VREGDNAVIT CNGSGSPLPD VDWIVTGLQS 250
    INTHQTNLNW TNVHAINLTL VNVTSEDNGF TLTCIAENVV GMSNASVALT 300
    VYYPPRVVSL VEPEVRLEHC IEFVVRGNPT PTLHWLYNGQ PLRESKIIHM 350
    DYYQEGEVSE GCLLFNKPTH YNNGNYTLIA KNALGTANQT INGHFLKEPF 400
    PESTDFFDFE SDASPTPPIT VTHKPEEDTF GVSIAVGLAA FACVLLVVLF 450
    IMINKYGRRS KFGMKGPVAV ISGEEDSASP LHHINHGITT PSSLDAGPDT 500
    VVIGMTRIPV IENPQYFRQG HNCHKPDTYV QHIKRRDIVL KRELGEGAFG 550
    KVFLAECYNL SPTKDKMLVA VKALKDPTLA ARKDFQREAE LLTNLQHEHI 600
    VKFYGVCGDG DPLIMVFEYM KHGDLNKFLR AHGPDAMILV DGQPRQAKGE 650
    LGLSQMLHIA SQIASGMVYL ASQHFVHRDL ATRNCLVGAN LLVKIGDFGM 700
    SRDVYSTDYY RVGGHTMLPI RWMPPESIMY RKFTTESDVW SFGVILWEIF 750
    TYGKQPWFQL SNTEVIECIT QGRVLERPRV CPKEVYDVML GCWQREPQQR 800
    LNIKEIYKIL HALGKATPIY LDILG 825
    Length:825
    Mass (Da):92,760
    Last modified:July 5, 2004 - v1
    Checksum:i4DE08AB546CC5BD6
    GO
    Isoform 2 (identifier: Q6VNS1-2) [UniParc]FASTAAdd to Basket

    Also known as: TrkC NC1

    The sequence of this isoform differs from the canonical sequence as follows:
         467-502: PVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVV → KVLFFQSQEFHGFHLLIKRYCTSICSLRKPLVTGPW
         503-825: Missing.

    Note: Non-catalytic.

    Show »
    Length:502
    Mass (Da):56,352
    Checksum:i535D9ED9D7AF50CC
    GO
    Isoform 3 (identifier: Q6VNS1-3) [UniParc]FASTAAdd to Basket

    Also known as: TrkC NC2

    The sequence of this isoform differs from the canonical sequence as follows:
         529-612: YVQHIKRRDI...FYGVCGDGDP → WVFSNIDNHG...VYFSKGRHGF
         613-825: Missing.

    Note: Non-catalytic.

    Show »
    Length:612
    Mass (Da):68,387
    Checksum:i376F0F449792CE46
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti366 – 3661N → K in AAC72289. (PubMed:9802700)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei467 – 50236PVAVI…PDTVV → KVLFFQSQEFHGFHLLIKRY CTSICSLRKPLVTGPW in isoform 2. 1 PublicationVSP_021596Add
    BLAST
    Alternative sequencei503 – 825323Missing in isoform 2. 1 PublicationVSP_021597Add
    BLAST
    Alternative sequencei529 – 61284YVQHI…GDGDP → WVFSNIDNHGILNLKDNRDH LVPSTHYIYEEPEVQSGDVS YPRSHGFREIMLNPISLSGH SKPLNHGIYVEDVNVYFSKG RHGF in isoform 3. 2 PublicationsVSP_021598Add
    BLAST
    Alternative sequencei613 – 825213Missing in isoform 3. 2 PublicationsVSP_021599Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY336094 mRNA. Translation: AAP94280.1.
    AF035399 mRNA. Translation: AAC72289.1.
    AF035400 mRNA. Translation: AAC72290.1.
    BC139764 mRNA. Translation: AAI39765.1.
    CCDSiCCDS21371.1. [Q6VNS1-1]
    CCDS21372.1. [Q6VNS1-3]
    RefSeqiNP_032772.3. NM_008746.5. [Q6VNS1-1]
    NP_877961.1. NM_182809.2. [Q6VNS1-3]
    UniGeneiMm.33496.
    Mm.421361.

    Genome annotation databases

    EnsembliENSMUST00000039431; ENSMUSP00000037909; ENSMUSG00000059146. [Q6VNS1-1]
    ENSMUST00000039438; ENSMUSP00000038324; ENSMUSG00000059146. [Q6VNS1-3]
    GeneIDi18213.
    KEGGimmu:18213.
    UCSCiuc009hxf.2. mouse. [Q6VNS1-1]
    uc009hxh.2. mouse. [Q6VNS1-3]
    uc009hxi.2. mouse. [Q6VNS1-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY336094 mRNA. Translation: AAP94280.1 .
    AF035399 mRNA. Translation: AAC72289.1 .
    AF035400 mRNA. Translation: AAC72290.1 .
    BC139764 mRNA. Translation: AAI39765.1 .
    CCDSi CCDS21371.1. [Q6VNS1-1 ]
    CCDS21372.1. [Q6VNS1-3 ]
    RefSeqi NP_032772.3. NM_008746.5. [Q6VNS1-1 ]
    NP_877961.1. NM_182809.2. [Q6VNS1-3 ]
    UniGenei Mm.33496.
    Mm.421361.

    3D structure databases

    ProteinModelPortali Q6VNS1.
    SMRi Q6VNS1. Positions 28-428, 529-818.
    ModBasei Search...
    MobiDBi Search...

    Chemistry

    ChEMBLi CHEMBL2791.

    PTM databases

    PhosphoSitei Q6VNS1.

    Proteomic databases

    PaxDbi Q6VNS1.
    PRIDEi Q6VNS1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000039431 ; ENSMUSP00000037909 ; ENSMUSG00000059146 . [Q6VNS1-1 ]
    ENSMUST00000039438 ; ENSMUSP00000038324 ; ENSMUSG00000059146 . [Q6VNS1-3 ]
    GeneIDi 18213.
    KEGGi mmu:18213.
    UCSCi uc009hxf.2. mouse. [Q6VNS1-1 ]
    uc009hxh.2. mouse. [Q6VNS1-3 ]
    uc009hxi.2. mouse. [Q6VNS1-2 ]

    Organism-specific databases

    CTDi 4916.
    MGIi MGI:97385. Ntrk3.

    Phylogenomic databases

    eggNOGi COG0515.
    GeneTreei ENSGT00730000110657.
    HOGENOMi HOG000264255.
    HOVERGENi HBG056735.
    InParanoidi Q6VNS1.
    KOi K05101.
    OMAi NFVSIYE.
    OrthoDBi EOG7GTT32.
    PhylomeDBi Q6VNS1.
    TreeFami TF106465.

    Miscellaneous databases

    NextBioi 293614.
    PROi Q6VNS1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6VNS1.
    Bgeei Q6VNS1.
    CleanExi MM_NTRK3.
    Genevestigatori Q6VNS1.

    Family and domain databases

    Gene3Di 2.60.40.10. 2 hits.
    InterProi IPR000483. Cys-rich_flank_reg_C.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR011009. Kinase-like_dom.
    IPR001611. Leu-rich_rpt.
    IPR000372. LRR-contain_N.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR020446. Tyr_kin_neurotrophic_rcpt_3.
    IPR008266. Tyr_kinase_AS.
    IPR020635. Tyr_kinase_cat_dom.
    IPR020777. Tyr_kinase_NGF_rcpt.
    IPR002011. Tyr_kinase_rcpt_2_CS.
    [Graphical view ]
    Pfami PF07679. I-set. 2 hits.
    PF13855. LRR_8. 1 hit.
    PF01462. LRRNT. 1 hit.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view ]
    PRINTSi PR01939. NTKRECEPTOR.
    PR01942. NTKRECEPTOR3.
    PR00109. TYRKINASE.
    SMARTi SM00409. IG. 1 hit.
    SM00082. LRRCT. 1 hit.
    SM00013. LRRNT. 1 hit.
    SM00219. TyrKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS50835. IG_LIKE. 1 hit.
    PS51450. LRR. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00109. PROTEIN_KINASE_TYR. 1 hit.
    PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Neurotrophin 3 activation of TrkC induces Schwann cell migration through the c-Jun N-terminal kinase pathway."
      Yamauchi J., Chan J.R., Shooter E.M.
      Proc. Natl. Acad. Sci. U.S.A. 100:14421-14426(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: BALB/c.
    2. "Differential expression of TrkC catalytic and noncatalytic isoforms suggests that they act independently or in association."
      Menn B., Timsit S., Calothy G., Lamballe F.
      J. Comp. Neurol. 401:47-64(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY.
      Strain: C57BL/6.
      Tissue: Brain.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    4. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
      Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
      J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-516, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    5. "p75 neurotrophin receptor is a clock gene that regulates oscillatory components of circadian and metabolic networks."
      Baeza-Raja B., Eckel-Mahan K., Zhang L., Vagena E., Tsigelny I.F., Sassone-Corsi P., Ptacek L.J., Akassoglou K.
      J. Neurosci. 33:10221-10234(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.

    Entry informationi

    Entry nameiNTRK3_MOUSE
    AccessioniPrimary (citable) accession number: Q6VNS1
    Secondary accession number(s): A4QPD0, Q9Z2P9, Q9Z2Q0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 28, 2006
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 105 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3