Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6V1P9 (PCD23_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protocadherin-23
Alternative name(s):
Cadherin-27
Cadherin-like protein CDHJ
Cadherin-like protein VR8
Protein dachsous homolog 2
Protocadherin PCDHJ
Gene names
Name:DCHS2
Synonyms:CDH27, CDHJ, PCDH23, PCDHJ
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2916 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Calcium-dependent cell-adhesion protein By similarity.

Subcellular location

Membrane; Single-pass membrane protein Potential.

Tissue specificity

Cerebral cortex and testis. Ref.1

Sequence similarities

Contains 22 cadherin domains.

Ontologies

Keywords
   Biological processCell adhesion
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
Transmembrane
Transmembrane helix
   LigandCalcium
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processhomophilic cell adhesion

Inferred from electronic annotation. Source: InterPro

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Inferred from electronic annotation. Source: InterPro

   Molecular_functioncalcium ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q6V1P9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6V1P9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1957: Missing.
Isoform 3 (identifier: Q6V1P9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: MRLDEITKSE...ENAKPVKETE → MSPCGRKMGE...HAPVGHCFLQ
     143-154: Missing.
     232-326: Missing.
     745-788: Missing.
     885-911: EDSSDHFKIDANNGEIRTTTILSYDYR → ARHMPLKGKTAFGKQSCKKQTNKQTKS
     912-2916: Missing.
Isoform 4 (identifier: Q6V1P9-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: MRLDEITKSE...ENAKPVKETE → MSPCGRKMGE...HAPVGHCFLQ
     143-154: Missing.
     232-326: Missing.
     745-788: Missing.
     885-914: EDSSDHFKIDANNGEIRTTTILSYDYRPSY → ARPMPLKGKTAFGKQSCKKQTNKQTNKILT
     915-2916: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 29162916Protocadherin-23
PRO_0000343410

Regions

Transmembrane2541 – 256121Helical; Potential
Domain56 – 177122Cadherin 1
Domain178 – 382205Cadherin 2
Domain378 – 480103Cadherin 3
Domain481 – 583103Cadherin 4
Domain586 – 692107Cadherin 5
Domain693 – 839147Cadherin 6
Domain844 – 960117Cadherin 7
Domain949 – 1055107Cadherin 8
Domain1056 – 1165110Cadherin 9
Domain1165 – 1269105Cadherin 10
Domain1270 – 1374105Cadherin 11
Domain1375 – 1478104Cadherin 12
Domain1479 – 1583105Cadherin 13
Domain1584 – 1685102Cadherin 14
Domain1685 – 1787103Cadherin 15
Domain1788 – 1892105Cadherin 16
Domain1892 – 1992101Cadherin 17
Domain1993 – 2094102Cadherin 18
Domain2095 – 2210116Cadherin 19
Domain2211 – 2314104Cadherin 20
Domain2315 – 2425111Cadherin 21
Domain2426 – 2533108Cadherin 22

Amino acid modifications

Glycosylation2201N-linked (GlcNAc...) Potential
Glycosylation2451N-linked (GlcNAc...) Potential
Glycosylation4061N-linked (GlcNAc...) Potential
Glycosylation4671N-linked (GlcNAc...) Potential
Glycosylation5391N-linked (GlcNAc...) Potential
Glycosylation6731N-linked (GlcNAc...) Potential
Glycosylation8201N-linked (GlcNAc...) Potential
Glycosylation10321N-linked (GlcNAc...) Potential
Glycosylation11401N-linked (GlcNAc...) Potential
Glycosylation12091N-linked (GlcNAc...) Potential
Glycosylation14431N-linked (GlcNAc...) Potential
Glycosylation15991N-linked (GlcNAc...) Potential
Glycosylation16151N-linked (GlcNAc...) Potential
Glycosylation18741N-linked (GlcNAc...) Potential
Glycosylation20241N-linked (GlcNAc...) Potential
Glycosylation20421N-linked (GlcNAc...) Potential
Glycosylation21001N-linked (GlcNAc...) Potential
Glycosylation22091N-linked (GlcNAc...) Potential
Glycosylation24741N-linked (GlcNAc...) Potential
Glycosylation25221N-linked (GlcNAc...) Potential
Glycosylation26351N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 19571957Missing in isoform 2.
VSP_034585
Alternative sequence1 – 7878MRLDE…VKETE → MSPCGRKMGEGRQQRRAPVG KLLLLPGRRDTPHGRSGSSG ARTQRSLLWLLVHVWLWAAS GSSAQLFNLTLSVDEGLPPD TLVGDIRAGLPAAQQQEGSG FFLSEDSDDSPLLDDFHVHP DTGIIRTARRLDRERRDHYS FVAATLLGAVVQVEIRVNDV NDHSPRFPLDSLQLDVSELS PPGTAFRLPVAHDPDAGLFS TQGYTLVQPSDLPKDPAGPF FQLRYRTPGPLPSPLLPGSS SPLEPLDLVLLRRLDREEAA AHRLQIEAWDGGRPRRTGLL SVELRVLDENDNPPVFEQDE YRAAVREDAQPGAEVCRVRA TDRDLGPNGFVRYSVRARQV PGAGSGGGALGDAAYFAVEE LSGVVRVWRPLDREAQAWHQ LVVEARDGGAEPEVATVRVS IAVLDVNDNRPAIHVLFLTE GGVARVSEGARPGDYVARVS VSDADGDWEKEDEATGELGV GLGDGSISLSLEGGEGDFAL LPGGPPGVFFLCVEGPLDRE SRDLYELLLVATDAGSPPLS TEETLLLRVADLNDQPPLFS QQHYKASVSEAAAPGTVVMW VSASDADEAGSDHAWLRYTV VQLSAPCNLGSLQSKMVHTA ECGPSFAIDSESGAISTIRT LDREVQEAVELKVVAQDLGE PPLSATCLVSITVDDVNDNE PIFWRQVYNATIAEHAPVGH CFLQ in isoform 3 and isoform 4.
VSP_034586
Alternative sequence143 – 15412Missing in isoform 3 and isoform 4.
VSP_034587
Alternative sequence232 – 32695Missing in isoform 3 and isoform 4.
VSP_034588
Alternative sequence745 – 78844Missing in isoform 3 and isoform 4.
VSP_034589
Alternative sequence885 – 91430EDSSD…YRPSY → ARPMPLKGKTAFGKQSCKKQ TNKQTNKILT in isoform 4.
VSP_046654
Alternative sequence885 – 91127EDSSD…SYDYR → ARHMPLKGKTAFGKQSCKKQ TNKQTKS in isoform 3.
VSP_034590
Alternative sequence912 – 29162005Missing in isoform 3.
VSP_034591
Alternative sequence915 – 29162002Missing in isoform 4.
VSP_046655
Natural variant1531V → A.
Corresponds to variant rs11721758 [ dbSNP | Ensembl ].
VAR_044362
Natural variant1741H → R.
Corresponds to variant rs10017772 [ dbSNP | Ensembl ].
VAR_044363
Natural variant3441S → L. Ref.2
Corresponds to variant rs6858712 [ dbSNP | Ensembl ].
VAR_044364
Natural variant8271V → I.
Corresponds to variant rs7666283 [ dbSNP | Ensembl ].
VAR_044365
Natural variant8971N → S.
Corresponds to variant rs1352714 [ dbSNP | Ensembl ].
VAR_044366
Natural variant12051S → L.
Corresponds to variant rs11935573 [ dbSNP | Ensembl ].
VAR_044367
Natural variant14801T → R.
Corresponds to variant rs17031394 [ dbSNP | Ensembl ].
VAR_044368
Natural variant15951E → Q.
Corresponds to variant rs28561984 [ dbSNP | Ensembl ].
VAR_061075
Natural variant21121T → M.
Corresponds to variant rs17031279 [ dbSNP | Ensembl ].
VAR_044369
Natural variant23031S → N.
Corresponds to variant rs6824133 [ dbSNP | Ensembl ].
VAR_044370

Experimental info

Sequence conflict20611Q → R in BAA90911. Ref.2
Sequence conflict20741L → P in BAA90911. Ref.2
Sequence conflict24751K → R in BAA90911. Ref.2
Sequence conflict26331H → Y in BAA90911. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 25B2F4496468ABB5

FASTA2,916322,234
        10         20         30         40         50         60 
MRLDEITKSE NEDGEKKMFT QQFESTDACV YEVYVKINSI VKSQSQCGLK RGSPETELWG 

        70         80         90        100        110        120 
AIVFRSQEEN AKPVKETEVT ASDADSGLYG FIEYSLYDGF LSYEAPQAFR IDPHDGQICV 

       130        140        150        160        170        180 
SQDIDRERDP ATYDLLVEAK DGDEQRMTHL ALVKGGLSAQ AFVRVDLEDV NDNHPVFNPS 

       190        200        210        220        230        240 
TYVTSISDET QPGTEIINVL ATDQDSGIYG TVAYELIPGN VSSLFTIDST TGLYSPEVEI 

       250        260        270        280        290        300 
LSAVNFSADK EVMNSLEMFL PLLRHFKKVE RDEEAAEKKF EASRGWFMRF KGRRHLHYLK 

       310        320        330        340        350        360 
VQDEAASADG EAAARYVANL AKILGEGIIY LTLPLSHLES TTLSLMVSAQ DGGGLTAVIN 

       370        380        390        400        410        420 
ADVTIHIFQT TLAPAEFERP KYTFLVYEDV PEDSPIGTVK AREPLNSSEP IFYRISSGDL 

       430        440        450        460        470        480 
GGKFSIHPRL GTIRTRKPLD HETQPVVVLT VQAQLGSAPA CSSTEVNITV MDVNDNHPAF 

       490        500        510        520        530        540 
LRTSDEIRIS QTTPPGTALY LARAEDRDSG RNGLIRYSIA SPQPGVFAID RALGVLFLNG 

       550        560        570        580        590        600 
SLGAGEQREL TLTLRAEDQG VHPQAALLVL TVVIEKREHS PSWTFEHLVY QVEVSESLSP 

       610        620        630        640        650        660 
MTQMLQTQAH PLGPQRAASP LRYSLEPSVD SAMFGIRPYT GWIYLRRQFD YESTQTYNFR 

       670        680        690        700        710        720 
VFAWIPEDGF LQNVSTTVIV RVWDENDNSP TFLHDVLFLK VEESPVPQGV IGKITAIDMD 

       730        740        750        760        770        780 
SGKNGQLLYF LLSDGKFFKM NPNTGPAGTI YVITWADGAA AFSGTDFAFS SDELQAFVLK 

       790        800        810        820        830        840 
SLFCELGEGE LINWVALDRE HRGHHEMTVL VTDRGSPPRN ATMAVYVSVT DINDNRPFFP 

       850        860        870        880        890        900 
QCLPGKELHV KVLEGQPVNM LVTTVFAKDP DEGNNAEVTY SVSSEDSSDH FKIDANNGEI 

       910        920        930        940        950        960 
RTTTILSYDY RPSYRMSVIA TDQGVPPLQG QAVVNIQVIP LSKGRAIMSQ NIRHLIIPEN 

       970        980        990       1000       1010       1020 
LKPTKIMSLI KSSDHLQQHY NGKLHFSIVA DDKDGHFEID SSTGDLFLSK ELDYETTSHY 

      1030       1040       1050       1060       1070       1080 
LFRVITTDHS KNLSLSSTVF LSIDVEDQND HSPSFQDELI VISVEENVPI GTLVYVFNAK 

      1090       1100       1110       1120       1130       1140 
DDDGSFLNSR IQYYIESHNP GTNPFLIHPS FGTLVTVSRL DRESIPTVIL TVTASDQAVN 

      1150       1160       1170       1180       1190       1200 
VTDRRLRSLT AQIVILDVND HNPTFISFPN AHVKEDVTVG SLVHHITAHD PDEGRNGKVT 

      1210       1220       1230       1240       1250       1260 
YSILSGNENM TFMLDESSGL LTTTCPLDYE MKTQHILTVL ALDDGTPALS SSQTLTVTVL 

      1270       1280       1290       1300       1310       1320 
DVNDEAPVFK QHLYEASVKE NQNPGEFVTR VEALDRDSGV NSKLQFEIMP GASFELFEIN 

      1330       1340       1350       1360       1370       1380 
SDTGEVVTTT ILDREIQEVF TLRVLVRDGG FPSLSSTTTI LCTVEDENDH APEFIVSSYD 

      1390       1400       1410       1420       1430       1440 
IEVLENQEPE VVYTVLASDM DAGNNRAVEY HIIDGNTDEC FTINEMSGEL STTRALDREQ 

      1450       1460       1470       1480       1490       1500 
ISNFTLVILC SDLGDPPRSS VIHLQVRVLD ANDHSPSFPT LYYQSSVRED AEVGTVVLVL 

      1510       1520       1530       1540       1550       1560 
SAVDKDEGLN GQTEYFLTDE ASGAFTIDPM SGTLKTSNTL DREARSQHTF SAVARDCSIQ 

      1570       1580       1590       1600       1610       1620 
GSRSTTVIIK VYVTDVNDND PVLEQNPFDV FLSPESPTNQ TTVIVRADDL DLGPNGTVVF 

      1630       1640       1650       1660       1670       1680 
SFAETQSMFS IDKYTGEIQF QQNPSSEYFP IWLQLKVTDQ GIPARTTTGL LVIHMEGEDV 

      1690       1700       1710       1720       1730       1740 
KISFSHHLYK GLVTENCEAG TSIVTVKAFA PDSIQDSMKY SIFSGNEDGV LSLCSKSGQL 

      1750       1760       1770       1780       1790       1800 
TVKEPKFLDF EVRNEVQLIV LAESSGHRAY CKVAVLIQDE NDNSPCFEQS IYQASVSESQ 

      1810       1820       1830       1840       1850       1860 
LYNAHVIQVF ATDLDSGLNG LIEYSILSGN QEEAFQIDAL SGVITTKAIL DYELTSSYSL 

      1870       1880       1890       1900       1910       1920 
IVQATDKGMP RLSNTTVIKV QVTDINDNAP AFLPSEAVEI TEDSLPGVIV THVSVHDVDL 

      1930       1940       1950       1960       1970       1980 
NSAFIFSFAK ESNPGTKFAI DQNTGVVVLV KTLDFEEMTE YELLIQISDS VHYTEGALVV 

      1990       2000       2010       2020       2030       2040 
RVLDVNDNPP VFSQDFYQVT VPESIPVGYS VLTLSATDLE SNENISYRIL SSSKEFSIDP 

      2050       2060       2070       2080       2090       2100 
KNGTIFTISP VLLLDTISTT QFLVEASDGG NPDLRALTLV EIGIEDMNNY APEFTVKSYN 

      2110       2120       2130       2140       2150       2160 
LSLSEDALVG STLVTFSNID HDWTRENTYV EYSIISGNSQ NNFHVETKFF HSEYPYKQVG 

      2170       2180       2190       2200       2210       2220 
YLVLLHSLDR EASASHELVI LASDSGCPPL SSTAVISIQV LDVNDNPPNF SSLSYHTHVK 

      2230       2240       2250       2260       2270       2280 
ESTPLGSHIT VVSANDRDTG SHAEIIYNII SGNEKGHFYL EENTGVLYLI KPLDYEKMTK 

      2290       2300       2310       2320       2330       2340 
FTLTVQASDA EKKHFSFAVV FVSVLDDNDH APQFMFSSFS CIVPENLPIS STICSINALD 

      2350       2360       2370       2380       2390       2400 
FDAGPYGELT YSIVSPCFLT HGMSYDHDLF LIDPLTGDIH AKQILDYENG NKYCLTVQAK 

      2410       2420       2430       2440       2450       2460 
DKGDATASLV VWVDIEGIDE FEPIFTQDQY FFTLPEKNKD RQLIGRVEAS DADAGIDGVI 

      2470       2480       2490       2500       2510       2520 
LYSLGTSSPF FSVNKTNGNI YLIRALPLIK SQLNKEDTLE MKIIAHSPKS DSKFASCTVF 

      2530       2540       2550       2560       2570       2580 
VNVSFSSEGT PLAVFASSFS ISLVVSFLVF LILICILIVM ILRHKQKDTI NNYEEKKTSS 

      2590       2600       2610       2620       2630       2640 
LDADLRVTRD ASVLKAFQKT DDCSNEVVPV DATPEWLSLI SIMEKDIVNL YRHSNSSGHC 

      2650       2660       2670       2680       2690       2700 
SVEGETAEDK EIQRINEHPY RKCSDSALSD HESRVPDSGI PRDSDQLSCL SGETDVMVTA 

      2710       2720       2730       2740       2750       2760 
ETAEASQTFG EGDQGEGCST TCAQNNVLPQ TVQKREAKES ILADVRKESV FISGDQEVRC 

      2770       2780       2790       2800       2810       2820 
AALSTQTTSD HDGKDNYHWN YLLSWEPKFQ PLASVFNDIA KLKDEHLHMP GIPKEKKSFV 

      2830       2840       2850       2860       2870       2880 
FPPPLITAVA QPGIKAVPPR MPAVNLGQVP PKHPRSPIPY HLGSLPEGMT PNFSPSLSLL 

      2890       2900       2910 
TMQPPALSPL LREGELLGTH ISGTCHELKA EDEVQI 

« Hide

Isoform 2 [UniParc].

Checksum: 6E38A65AC08CE8BB
Show »

FASTA959105,922
Isoform 3 [UniParc].

Checksum: 6B09AD4EC7F5C7BF
Show »

FASTA1,366148,990
Isoform 4 [UniParc].

Checksum: EF67CCC40F454EC7
Show »

FASTA1,369149,304

References

« Hide 'large scale' references
[1]"Identification of new human cadherin genes using a combination of protein motif search and gene finding methods."
Hoeng J.C., Ivanov N.V., Hodor P., Xia M., Wei N., Blevins R., Gerhold D., Borodovsky M., Liu Y.
J. Mol. Biol. 337:307-317(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT LEU-344.
Tissue: Colon.
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY354497 mRNA. Translation: AAR10443.1.
AK000054 mRNA. Translation: BAA90911.1.
AK127704 mRNA. Translation: BAC87093.1.
AC079298 Genomic DNA. Translation: AAY41019.1.
AC110608 Genomic DNA. No translation available.
AC110775 Genomic DNA. No translation available.
RefSeqNP_001136024.1. NM_001142552.1.
NP_060109.2. NM_017639.3.
UniGeneHs.655664.

3D structure databases

ProteinModelPortalQ6V1P9.
SMRQ6V1P9. Positions 61-235, 328-2526.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120157. 1 interaction.
STRING9606.ENSP00000349768.

PTM databases

PhosphoSiteQ6V1P9.

Polymorphism databases

DMDM74762378.

Proteomic databases

PaxDbQ6V1P9.
PRIDEQ6V1P9.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000339452; ENSP00000345062; ENSG00000197410. [Q6V1P9-4]
ENST00000357232; ENSP00000349768; ENSG00000197410. [Q6V1P9-1]
GeneID54798.
KEGGhsa:54798.
UCSCuc003inw.2. human. [Q6V1P9-1]

Organism-specific databases

CTD54798.
GeneCardsGC04M155155.
H-InvDBHIX0004584.
HGNCHGNC:23111. DCHS2.
MIM612486. gene.
neXtProtNX_Q6V1P9.
PharmGKBPA134953793.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG12793.
HOGENOMHOG000115466.
HOVERGENHBG053522.
InParanoidQ6V1P9.
KOK16507.
OMADKDGHFE.
OrthoDBEOG75TM9Z.
PhylomeDBQ6V1P9.
TreeFamTF330641.

Gene expression databases

ArrayExpressQ6V1P9.
BgeeQ6V1P9.
CleanExHS_DCHS2.
GenevestigatorQ6V1P9.

Family and domain databases

Gene3D2.60.40.60. 24 hits.
InterProIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view]
PfamPF00028. Cadherin. 17 hits.
[Graphical view]
PRINTSPR00205. CADHERIN.
SMARTSM00112. CA. 21 hits.
[Graphical view]
SUPFAMSSF49313. SSF49313. 23 hits.
PROSITEPS00232. CADHERIN_1. 13 hits.
PS50268. CADHERIN_2. 22 hits.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiDCHS2.
GenomeRNAi54798.
NextBio57483.
PROQ6V1P9.
SOURCESearch...

Entry information

Entry namePCD23_HUMAN
AccessionPrimary (citable) accession number: Q6V1P9
Secondary accession number(s): E9PC11 expand/collapse secondary AC list , Q4W5P9, Q6ZS61, Q9NXU8
Entry history
Integrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM