Q6UXX9 (RSPO2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 61.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: R-spondin-2 Alternative name(s): Roof plate-specific spondin-2 Short name=hRspo2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 243 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent beta catenin pathway through a receptor signaling pathway that may not use frizzled/LRP receptors. Probably also acts as a ligand for frizzled and LRP receptors By similarity. |
| Subunit structure | Interacts with WNT1. Binds heparin By similarity. |
| Subcellular location | Secreted By similarity. |
| Domain | The FU repeat is required for activation and stabilization of beta-catenin By similarity. |
| Miscellaneous | Upon injection into mice, it induces rapid onset of crypt cell proliferation involving beta-catenin stabilization. It also displays efficacy in a model of chemotherapy-induced intestinal mucositis. |
| Sequence similarities | Belongs to the R-spondin family. Contains 1 FU (furin-like) repeat. Contains 1 TSP type-1 domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Sensory transduction Wnt signaling pathway |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Ligand | Heparin-binding |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | Wnt receptor signaling pathway Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | heparin binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6UXX9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6UXX9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-67: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q6UXX9-3) The sequence of this isoform differs from the canonical sequence as follows: 32-95: ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCAR → G 143-143: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Potential | ||||||||
| Chain | 22 – 243 | 222 | R-spondin-2 | PRO_0000234439 | |||||||
Regions | |||||||||||
| Repeat | 90 – 134 | 45 | FU | ||||||||
| Domain | 144 – 204 | 61 | TSP type-1 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 160 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 145 ↔ 187 | By similarity | |||||||||
| Disulfide bond | 156 ↔ 163 | By similarity | |||||||||
| Disulfide bond | 196 ↔ 203 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 67 | 67 | Missing in isoform 2. | VSP_018321 | |||||||
| Alternative sequence | 32 – 95 | 64 | ASYVS…NRCAR → G in isoform 3. | VSP_018322 | |||||||
| Alternative sequence | 143 | 1 | Missing in isoform 3. | VSP_018323 | |||||||
| Natural variant | 186 | 1 | L → P. Ref.1 Ref.2 Ref.4 Ref.5 Corresponds to variant rs601558 [ dbSNP | Ensembl ]. | VAR_026247 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-186. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-186. Tissue: Brain. |
| [3] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT PRO-186. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT PRO-186. Tissue: Lung and Testis. |
| [6] | "R-spondin proteins: a novel link to beta-catenin activation." Kim K.-A., Zhao J., Andarmani S., Kakitani M., Oshima T., Binnerts M.E., Abo A., Tomizuka K., Funk W.D. Cell Cycle 5:23-26(2006) [PubMed: 16357527] [Abstract] Cited for: INJECTION INTO MICE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY358166 mRNA. Translation: AAQ88533.1. AK123023 mRNA. Translation: BAG53852.1. AC025508 Genomic DNA. No translation available. AP003479 Genomic DNA. No translation available. CH471060 Genomic DNA. Translation: EAW91916.1. BC027938 mRNA. Translation: AAH27938.1. BC036554 mRNA. Translation: AAH36554.1. |
| IPI | IPI00167122. IPI00640775. IPI00747330. |
| RefSeq | NP_848660.3. NM_178565.4. |
| UniGene | Hs.444834. |
3D structure databases | |
| ProteinModelPortal | Q6UXX9. |
| SMR | Q6UXX9. Positions 39-205. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q6UXX9. |
Polymorphism databases | |
| DMDM | 147744588. |
Proteomic databases | |
| PRIDE | Q6UXX9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000276659; ENSP00000276659; ENSG00000147655. |
| GeneID | 340419. |
| KEGG | hsa:340419. |
| NMPDR | fig|9606.3.peg.30648. |
| UCSC | uc003ymq.1. human. uc003ymr.1. human. |
Organism-specific databases | |
| CTD | 340419. |
| GeneCards | GC08M108981. |
| H-InvDB | HIX0007721. |
| HGNC | HGNC:28583. RSPO2. |
| HPA | CAB025900. HPA024764. |
| MIM | 610575. gene. |
| neXtProt | NX_Q6UXX9. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG18969. |
| GeneTree | ENSGT00390000011447. |
| HOGENOM | HBG715962. |
| HOVERGEN | HBG082751. |
| InParanoid | Q6UXX9. |
| OMA | HCPGGKR. |
| PhylomeDB | Q6UXX9. |
Gene expression databases | |
| ArrayExpress | Q6UXX9. |
| Bgee | Q6UXX9. |
| CleanEx | HS_RSPO2. |
| Genevestigator | Q6UXX9. |
| GermOnline | ENSG00000147655. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006212. Furin_repeat. IPR009030. Growth_fac_rcpt. IPR000884. Thrombospondin_1_rpt. [Graphical view] |
| SMART | SM00261. FU. 2 hits. SM00209. TSP1. 1 hit. [Graphical view] |
| SUPFAM | SSF57184. Grow_fac_recept. 1 hit. SSF82895. TSP1. 1 hit. |
| PROSITE | PS50092. TSP1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 97857. |
| SOURCE | Search... |
Entry information
| Entry name | RSPO2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6UXX9 Secondary accession number(s): B3KVP0, Q4G0U4, Q8N6X6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with