Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6UXI9

- NPNT_HUMAN

UniProt

Q6UXI9 - NPNT_HUMAN

Protein

Nephronectin

Gene

NPNT

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 90 (01 Oct 2014)
      Sequence version 3 (02 Nov 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functional ligand of integrin alpha-8/beta-1 in kidney development. Regulates the expression of GDNF with integrin alpha-8/beta-1 which is essential for kidney development. May also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins By similarity.By similarity

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. integrin binding Source: BHF-UCL

    GO - Biological processi

    1. branching involved in ureteric bud morphogenesis Source: BHF-UCL
    2. cell-cell adhesion mediated by integrin Source: BHF-UCL
    3. cell-matrix adhesion Source: BHF-UCL
    4. cellular response to tumor necrosis factor Source: BHF-UCL
    5. establishment of protein localization Source: Ensembl
    6. extracellular matrix organization Source: BHF-UCL
    7. pilomotor reflex Source: Ensembl
    8. positive regulation of alkaline phosphatase activity Source: Ensembl
    9. positive regulation of cell-substrate adhesion Source: BHF-UCL
    10. positive regulation of ERK1 and ERK2 cascade Source: BHF-UCL
    11. positive regulation of osteoblast differentiation Source: BHF-UCL
    12. positive regulation of smooth muscle contraction Source: Ensembl
    13. positive regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiation Source: Ensembl
    14. positive regulation of transforming growth factor beta receptor signaling pathway Source: Ensembl
    15. ureteric bud development Source: BHF-UCL

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Cell adhesion, Differentiation

    Keywords - Ligandi

    Calcium

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nephronectin
    Alternative name(s):
    Preosteoblast EGF-like repeat protein with MAM domain
    Protein EGFL6-like
    Gene namesi
    Name:NPNT
    Synonyms:EGFL6L, POEM
    ORF Names:UNQ295/PRO334
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:27405. NPNT.

    Subcellular locationi

    Secretedextracellular spaceextracellular matrix By similarity
    Note: Trapped on the cell surface or in the extracellular matrix.By similarity

    GO - Cellular componenti

    1. basement membrane Source: Ensembl
    2. extracellular region Source: BHF-UCL
    3. extracellular vesicular exosome Source: UniProt
    4. integrin alpha8-beta1 complex Source: Ensembl
    5. proteinaceous extracellular matrix Source: BHF-UCL
    6. smooth muscle contractile fiber Source: Ensembl

    Keywords - Cellular componenti

    Extracellular matrix, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1919Sequence AnalysisAdd
    BLAST
    Chaini20 – 565546NephronectinPRO_0000295684Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi56 ↔ 69PROSITE-ProRule annotation
    Disulfide bondi60 ↔ 75PROSITE-ProRule annotation
    Disulfide bondi77 ↔ 86PROSITE-ProRule annotation
    Disulfide bondi93 ↔ 104PROSITE-ProRule annotation
    Disulfide bondi100 ↔ 113PROSITE-ProRule annotation
    Disulfide bondi115 ↔ 127PROSITE-ProRule annotation
    Disulfide bondi173 ↔ 186PROSITE-ProRule annotation
    Disulfide bondi180 ↔ 195PROSITE-ProRule annotation
    Disulfide bondi197 ↔ 212PROSITE-ProRule annotation
    Disulfide bondi218 ↔ 231PROSITE-ProRule annotation
    Disulfide bondi225 ↔ 240PROSITE-ProRule annotation
    Disulfide bondi242 ↔ 253PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDbiQ6UXI9.
    PRIDEiQ6UXI9.

    PTM databases

    PhosphoSiteiQ6UXI9.

    Expressioni

    Tissue specificityi

    Expressed in kidney and lung and to a lower extent in brain, pregnant uterus, placenta, thyroid gland and blood vessels.1 Publication

    Developmental stagei

    Expressed in fetal kidney, cochlea, eye, heart and lung.1 Publication

    Gene expression databases

    ArrayExpressiQ6UXI9.
    BgeeiQ6UXI9.
    CleanExiHS_NPNT.
    GenevestigatoriQ6UXI9.

    Organism-specific databases

    HPAiHPA003711.

    Interactioni

    Subunit structurei

    Homodimer and homotrimer.By similarity

    Protein-protein interaction databases

    BioGridi129117. 1 interaction.
    STRINGi9606.ENSP00000369323.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6UXI9.
    SMRiQ6UXI9. Positions 34-242, 422-562.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini52 – 8736EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini89 – 12840EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini132 – 16837EGF-like 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini169 – 21345EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini214 – 25441EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini420 – 563144MAMPROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi382 – 3843Integrin interaction

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi296 – 36570Pro-richAdd
    BLAST

    Domaini

    The MAM domain is required for localization at the cell surface.By similarity

    Sequence similaritiesi

    Belongs to the nephronectin family.Curated
    Contains 5 EGF-like domains.PROSITE-ProRule annotation
    Contains 1 MAM domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Repeat, Signal

    Phylogenomic databases

    eggNOGiNOG254583.
    HOGENOMiHOG000059638.
    HOVERGENiHBG108200.
    InParanoidiQ6UXI9.
    KOiK06824.
    OrthoDBiEOG73RBB8.
    PhylomeDBiQ6UXI9.
    TreeFamiTF330819.

    Family and domain databases

    InterProiIPR008985. ConA-like_lec_gl_sf.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR009030. Growth_fac_rcpt_N_dom.
    IPR000998. MAM_dom.
    [Graphical view]
    PfamiPF07645. EGF_CA. 3 hits.
    PF00629. MAM. 1 hit.
    [Graphical view]
    SMARTiSM00181. EGF. 3 hits.
    SM00179. EGF_CA. 2 hits.
    [Graphical view]
    SUPFAMiSSF49899. SSF49899. 1 hit.
    SSF57184. SSF57184. 2 hits.
    PROSITEiPS00010. ASX_HYDROXYL. 3 hits.
    PS00022. EGF_1. 1 hit.
    PS01186. EGF_2. 3 hits.
    PS50026. EGF_3. 4 hits.
    PS01187. EGF_CA. 3 hits.
    PS50060. MAM_2. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6UXI9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDFLLALVLV SSLYLQAAAE FDGRWPRQIV SSIGLCRYGG RIDCCWGWAR    50
    QSWGQCQPVC QPRCKHGECI GPNKCKCHPG YAGKTCNQDL NECGLKPRPC 100
    KHRCMNTYGS YKCYCLNGYM LMPDGSCSSA LTCSMANCQY GCDVVKGQIR 150
    CQCPSPGLQL APDGRTCVDV DECATGRASC PRFRQCVNTF GSYICKCHKG 200
    FDLMYIGGKY QCHDIDECSL GQYQCSSFAR CYNIRGSYKC KCKEGYQGDG 250
    LTCVYIPKVM IEPSGPIHVP KGNGTILKGD TGNNNWIPDV GSTWWPPKTP 300
    YIPPIITNRP TSKPTTRPTP KPTPIPTPPP PPPLPTELRT PLPPTTPERP 350
    TTGLTTIAPA ASTPPGGITV DNRVQTDPQK PRGDVFIPRQ PSNDLFEIFE 400
    IERGVSADDE AKDDPGVLVH SCNFDHGLCG WIREKDNDLH WEPIRDPAGG 450
    QYLTVSAAKA PGGKAARLVL PLGRLMHSGD LCLSFRHKVT GLHSGTLQVF 500
    VRKHGAHGAA LWGRNGGHGW RQTQITLRGA DIKSVVFKGE KRRGHTGEIG 550
    LDDVSLKKGH CSEER 565
    Length:565
    Mass (Da):61,907
    Last modified:November 2, 2010 - v3
    Checksum:iD4AB4C41B7D5A819
    GO
    Isoform 2 (identifier: Q6UXI9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S
         535-564: VVFKGEKRRGHTGEIGLDDVSLKKGHCSEE → ESQ

    Note: No experimental confirmation available.

    Show »
    Length:509
    Mass (Da):55,702
    Checksum:iE3D7FB3650B7BA29
    GO
    Isoform 3 (identifier: Q6UXI9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         88-88: Q → QDEHIPAPLDQGSEQPLFQPLDHQATSLPSR

    Note: No experimental confirmation available.

    Show »
    Length:595
    Mass (Da):65,213
    Checksum:i2A44A7A18BEE77FC
    GO
    Isoform 4 (identifier: Q6UXI9-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         88-88: Q → QDEHIPAPLDQGSEQPLFQPLDHQATSLPSR
         387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S

    Note: No experimental confirmation available.

    Show »
    Length:566
    Mass (Da):61,958
    Checksum:iB440DC01AB4FF573
    GO
    Isoform 5 (identifier: Q6UXI9-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S

    Note: No experimental confirmation available.

    Show »
    Length:536
    Mass (Da):58,651
    Checksum:i6DC363CBA70A8AA0
    GO
    Isoform 6 (identifier: Q6UXI9-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         58-58: P → PFYVLRQRIARIRCQLKA

    Note: No experimental confirmation available.

    Show »
    Length:582
    Mass (Da):64,023
    Checksum:i256AD053250C578A
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti20 – 201E → K in BAG63765. (PubMed:14702039)Curated
    Sequence conflicti340 – 3401T → A in BAG65139. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti159 – 1591Q → H.1 Publication
    Corresponds to variant rs35132891 [ dbSNP | Ensembl ].
    VAR_033314
    Natural varianti234 – 2341I → V.3 Publications
    Corresponds to variant rs4340795 [ dbSNP | Ensembl ].
    VAR_033315
    Natural varianti473 – 4731G → S.
    Corresponds to variant rs35613262 [ dbSNP | Ensembl ].
    VAR_033316
    Natural varianti476 – 4761M → T.
    Corresponds to variant rs35488797 [ dbSNP | Ensembl ].
    VAR_033317

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei58 – 581P → PFYVLRQRIARIRCQLKA in isoform 6. 1 PublicationVSP_046131
    Alternative sequencei88 – 881Q → QDEHIPAPLDQGSEQPLFQP LDHQATSLPSR in isoform 3 and isoform 4. 1 PublicationVSP_045813
    Alternative sequencei387 – 41630IPRQP…KDDPG → S in isoform 2, isoform 4 and isoform 5. 2 PublicationsVSP_026987Add
    BLAST
    Alternative sequencei535 – 56430VVFKG…HCSEE → ESQ in isoform 2. 1 PublicationVSP_026988Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY358336 mRNA. Translation: AAQ88702.1.
    AK290029 mRNA. Translation: BAF82718.1.
    AK295772 mRNA. Translation: BAG58596.1.
    AK302477 mRNA. Translation: BAG63765.1.
    AK304279 mRNA. Translation: BAG65139.1.
    AK304721 mRNA. Translation: BAG65484.1.
    AC093782 Genomic DNA. No translation available.
    AC109361 Genomic DNA. No translation available.
    CH471057 Genomic DNA. Translation: EAX06196.1.
    CCDSiCCDS34046.1. [Q6UXI9-1]
    CCDS54784.1. [Q6UXI9-6]
    CCDS54785.1. [Q6UXI9-3]
    CCDS54786.1. [Q6UXI9-4]
    CCDS54787.1. [Q6UXI9-5]
    RefSeqiNP_001028219.1. NM_001033047.2. [Q6UXI9-1]
    NP_001171619.1. NM_001184690.1. [Q6UXI9-6]
    NP_001171620.1. NM_001184691.1. [Q6UXI9-3]
    NP_001171621.1. NM_001184692.1. [Q6UXI9-5]
    NP_001171622.1. NM_001184693.1. [Q6UXI9-4]
    UniGeneiHs.518921.

    Genome annotation databases

    EnsembliENST00000305572; ENSP00000302557; ENSG00000168743. [Q6UXI9-2]
    ENST00000379987; ENSP00000369323; ENSG00000168743. [Q6UXI9-1]
    ENST00000427316; ENSP00000389252; ENSG00000168743. [Q6UXI9-3]
    ENST00000453617; ENSP00000402884; ENSG00000168743. [Q6UXI9-6]
    ENST00000506666; ENSP00000422474; ENSG00000168743. [Q6UXI9-4]
    ENST00000514622; ENSP00000422044; ENSG00000168743. [Q6UXI9-5]
    GeneIDi255743.
    KEGGihsa:255743.
    UCSCiuc003hya.3. human. [Q6UXI9-1]

    Polymorphism databases

    DMDMi311033424.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY358336 mRNA. Translation: AAQ88702.1 .
    AK290029 mRNA. Translation: BAF82718.1 .
    AK295772 mRNA. Translation: BAG58596.1 .
    AK302477 mRNA. Translation: BAG63765.1 .
    AK304279 mRNA. Translation: BAG65139.1 .
    AK304721 mRNA. Translation: BAG65484.1 .
    AC093782 Genomic DNA. No translation available.
    AC109361 Genomic DNA. No translation available.
    CH471057 Genomic DNA. Translation: EAX06196.1 .
    CCDSi CCDS34046.1. [Q6UXI9-1 ]
    CCDS54784.1. [Q6UXI9-6 ]
    CCDS54785.1. [Q6UXI9-3 ]
    CCDS54786.1. [Q6UXI9-4 ]
    CCDS54787.1. [Q6UXI9-5 ]
    RefSeqi NP_001028219.1. NM_001033047.2. [Q6UXI9-1 ]
    NP_001171619.1. NM_001184690.1. [Q6UXI9-6 ]
    NP_001171620.1. NM_001184691.1. [Q6UXI9-3 ]
    NP_001171621.1. NM_001184692.1. [Q6UXI9-5 ]
    NP_001171622.1. NM_001184693.1. [Q6UXI9-4 ]
    UniGenei Hs.518921.

    3D structure databases

    ProteinModelPortali Q6UXI9.
    SMRi Q6UXI9. Positions 34-242, 422-562.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 129117. 1 interaction.
    STRINGi 9606.ENSP00000369323.

    PTM databases

    PhosphoSitei Q6UXI9.

    Polymorphism databases

    DMDMi 311033424.

    Proteomic databases

    PaxDbi Q6UXI9.
    PRIDEi Q6UXI9.

    Protocols and materials databases

    DNASUi 255743.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000305572 ; ENSP00000302557 ; ENSG00000168743 . [Q6UXI9-2 ]
    ENST00000379987 ; ENSP00000369323 ; ENSG00000168743 . [Q6UXI9-1 ]
    ENST00000427316 ; ENSP00000389252 ; ENSG00000168743 . [Q6UXI9-3 ]
    ENST00000453617 ; ENSP00000402884 ; ENSG00000168743 . [Q6UXI9-6 ]
    ENST00000506666 ; ENSP00000422474 ; ENSG00000168743 . [Q6UXI9-4 ]
    ENST00000514622 ; ENSP00000422044 ; ENSG00000168743 . [Q6UXI9-5 ]
    GeneIDi 255743.
    KEGGi hsa:255743.
    UCSCi uc003hya.3. human. [Q6UXI9-1 ]

    Organism-specific databases

    CTDi 255743.
    GeneCardsi GC04P106816.
    H-InvDB HIX0004424.
    HGNCi HGNC:27405. NPNT.
    HPAi HPA003711.
    MIMi 610306. gene.
    neXtProti NX_Q6UXI9.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG254583.
    HOGENOMi HOG000059638.
    HOVERGENi HBG108200.
    InParanoidi Q6UXI9.
    KOi K06824.
    OrthoDBi EOG73RBB8.
    PhylomeDBi Q6UXI9.
    TreeFami TF330819.

    Miscellaneous databases

    ChiTaRSi NPNT. human.
    GenomeRNAii 255743.
    NextBioi 92630.
    PROi Q6UXI9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6UXI9.
    Bgeei Q6UXI9.
    CleanExi HS_NPNT.
    Genevestigatori Q6UXI9.

    Family and domain databases

    InterProi IPR008985. ConA-like_lec_gl_sf.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR009030. Growth_fac_rcpt_N_dom.
    IPR000998. MAM_dom.
    [Graphical view ]
    Pfami PF07645. EGF_CA. 3 hits.
    PF00629. MAM. 1 hit.
    [Graphical view ]
    SMARTi SM00181. EGF. 3 hits.
    SM00179. EGF_CA. 2 hits.
    [Graphical view ]
    SUPFAMi SSF49899. SSF49899. 1 hit.
    SSF57184. SSF57184. 2 hits.
    PROSITEi PS00010. ASX_HYDROXYL. 3 hits.
    PS00022. EGF_1. 1 hit.
    PS01186. EGF_2. 3 hits.
    PS50026. EGF_3. 4 hits.
    PS01187. EGF_CA. 3 hits.
    PS50060. MAM_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS HIS-159 AND VAL-234.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4; 5 AND 6), VARIANT VAL-234.
      Tissue: Hippocampus, Testis, Trachea and Uterus.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-234.
    5. "Identification and characterization of a novel human nephronectin gene in silico."
      Huang J.T.-J., Lee V.
      Int. J. Mol. Med. 15:719-724(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

    Entry informationi

    Entry nameiNPNT_HUMAN
    AccessioniPrimary (citable) accession number: Q6UXI9
    Secondary accession number(s): A6NFT9
    , A8K1W4, B4DIT4, B4DYK3, B4E2H7, B4E3H2, D6RCA1, E9PCK8, E9PCQ1, E9PE64, E9PF04
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 24, 2007
    Last sequence update: November 2, 2010
    Last modified: October 1, 2014
    This is version 90 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3