Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6UXI9

- NPNT_HUMAN

UniProt

Q6UXI9 - NPNT_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nephronectin

Gene

NPNT

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Functional ligand of integrin alpha-8/beta-1 in kidney development. Regulates the expression of GDNF with integrin alpha-8/beta-1 which is essential for kidney development. May also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins (By similarity).By similarity

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. integrin binding Source: BHF-UCL

GO - Biological processi

  1. branching involved in ureteric bud morphogenesis Source: BHF-UCL
  2. cell-cell adhesion mediated by integrin Source: BHF-UCL
  3. cell-matrix adhesion Source: BHF-UCL
  4. cellular response to tumor necrosis factor Source: BHF-UCL
  5. establishment of protein localization Source: Ensembl
  6. extracellular matrix organization Source: BHF-UCL
  7. pilomotor reflex Source: Ensembl
  8. positive regulation of alkaline phosphatase activity Source: Ensembl
  9. positive regulation of cell-substrate adhesion Source: BHF-UCL
  10. positive regulation of ERK1 and ERK2 cascade Source: BHF-UCL
  11. positive regulation of osteoblast differentiation Source: BHF-UCL
  12. positive regulation of smooth muscle contraction Source: Ensembl
  13. positive regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiation Source: Ensembl
  14. positive regulation of transforming growth factor beta receptor signaling pathway Source: Ensembl
  15. ureteric bud development Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cell adhesion, Differentiation

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Nephronectin
Alternative name(s):
Preosteoblast EGF-like repeat protein with MAM domain
Protein EGFL6-like
Gene namesi
Name:NPNT
Synonyms:EGFL6L, POEM
ORF Names:UNQ295/PRO334
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:27405. NPNT.

Subcellular locationi

Secretedextracellular spaceextracellular matrix By similarity
Note: Trapped on the cell surface or in the extracellular matrix.By similarity

GO - Cellular componenti

  1. basement membrane Source: Ensembl
  2. extracellular region Source: BHF-UCL
  3. extracellular vesicular exosome Source: UniProt
  4. integrin alpha8-beta1 complex Source: Ensembl
  5. proteinaceous extracellular matrix Source: BHF-UCL
  6. smooth muscle contractile fiber Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 565546NephronectinPRO_0000295684Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi56 ↔ 69PROSITE-ProRule annotation
Disulfide bondi60 ↔ 75PROSITE-ProRule annotation
Disulfide bondi77 ↔ 86PROSITE-ProRule annotation
Disulfide bondi93 ↔ 104PROSITE-ProRule annotation
Disulfide bondi100 ↔ 113PROSITE-ProRule annotation
Disulfide bondi115 ↔ 127PROSITE-ProRule annotation
Disulfide bondi173 ↔ 186PROSITE-ProRule annotation
Disulfide bondi180 ↔ 195PROSITE-ProRule annotation
Disulfide bondi197 ↔ 212PROSITE-ProRule annotation
Disulfide bondi218 ↔ 231PROSITE-ProRule annotation
Disulfide bondi225 ↔ 240PROSITE-ProRule annotation
Disulfide bondi242 ↔ 253PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ6UXI9.
PRIDEiQ6UXI9.

PTM databases

PhosphoSiteiQ6UXI9.

Expressioni

Tissue specificityi

Expressed in kidney and lung and to a lower extent in brain, pregnant uterus, placenta, thyroid gland and blood vessels.1 Publication

Developmental stagei

Expressed in fetal kidney, cochlea, eye, heart and lung.1 Publication

Gene expression databases

BgeeiQ6UXI9.
CleanExiHS_NPNT.
ExpressionAtlasiQ6UXI9. baseline and differential.
GenevestigatoriQ6UXI9.

Organism-specific databases

HPAiHPA003711.

Interactioni

Subunit structurei

Homodimer and homotrimer.By similarity

Protein-protein interaction databases

BioGridi129117. 1 interaction.
STRINGi9606.ENSP00000369323.

Structurei

3D structure databases

ProteinModelPortaliQ6UXI9.
SMRiQ6UXI9. Positions 34-254, 422-562.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini52 – 8736EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini89 – 12840EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini132 – 16837EGF-like 3PROSITE-ProRule annotationAdd
BLAST
Domaini169 – 21345EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini214 – 25441EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini420 – 563144MAMPROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi382 – 3843Integrin interaction

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi296 – 36570Pro-richAdd
BLAST

Domaini

The MAM domain is required for localization at the cell surface.By similarity

Sequence similaritiesi

Belongs to the nephronectin family.Curated
Contains 5 EGF-like domains.PROSITE-ProRule annotation
Contains 1 MAM domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG254583.
GeneTreeiENSGT00750000117321.
HOGENOMiHOG000059638.
HOVERGENiHBG108200.
InParanoidiQ6UXI9.
KOiK06824.
OrthoDBiEOG73RBB8.
PhylomeDBiQ6UXI9.
TreeFamiTF330819.

Family and domain databases

InterProiIPR013320. ConA-like_dom.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000998. MAM_dom.
[Graphical view]
PfamiPF07645. EGF_CA. 3 hits.
PF00629. MAM. 1 hit.
[Graphical view]
SMARTiSM00181. EGF. 3 hits.
SM00179. EGF_CA. 2 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
SSF57184. SSF57184. 2 hits.
PROSITEiPS00010. ASX_HYDROXYL. 3 hits.
PS00022. EGF_1. 1 hit.
PS01186. EGF_2. 3 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 3 hits.
PS50060. MAM_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6UXI9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDFLLALVLV SSLYLQAAAE FDGRWPRQIV SSIGLCRYGG RIDCCWGWAR
60 70 80 90 100
QSWGQCQPVC QPRCKHGECI GPNKCKCHPG YAGKTCNQDL NECGLKPRPC
110 120 130 140 150
KHRCMNTYGS YKCYCLNGYM LMPDGSCSSA LTCSMANCQY GCDVVKGQIR
160 170 180 190 200
CQCPSPGLQL APDGRTCVDV DECATGRASC PRFRQCVNTF GSYICKCHKG
210 220 230 240 250
FDLMYIGGKY QCHDIDECSL GQYQCSSFAR CYNIRGSYKC KCKEGYQGDG
260 270 280 290 300
LTCVYIPKVM IEPSGPIHVP KGNGTILKGD TGNNNWIPDV GSTWWPPKTP
310 320 330 340 350
YIPPIITNRP TSKPTTRPTP KPTPIPTPPP PPPLPTELRT PLPPTTPERP
360 370 380 390 400
TTGLTTIAPA ASTPPGGITV DNRVQTDPQK PRGDVFIPRQ PSNDLFEIFE
410 420 430 440 450
IERGVSADDE AKDDPGVLVH SCNFDHGLCG WIREKDNDLH WEPIRDPAGG
460 470 480 490 500
QYLTVSAAKA PGGKAARLVL PLGRLMHSGD LCLSFRHKVT GLHSGTLQVF
510 520 530 540 550
VRKHGAHGAA LWGRNGGHGW RQTQITLRGA DIKSVVFKGE KRRGHTGEIG
560
LDDVSLKKGH CSEER
Length:565
Mass (Da):61,907
Last modified:November 2, 2010 - v3
Checksum:iD4AB4C41B7D5A819
GO
Isoform 2 (identifier: Q6UXI9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S
     535-564: VVFKGEKRRGHTGEIGLDDVSLKKGHCSEE → ESQ

Note: No experimental confirmation available.

Show »
Length:509
Mass (Da):55,702
Checksum:iE3D7FB3650B7BA29
GO
Isoform 3 (identifier: Q6UXI9-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: Q → QDEHIPAPLDQGSEQPLFQPLDHQATSLPSR

Note: No experimental confirmation available.

Show »
Length:595
Mass (Da):65,213
Checksum:i2A44A7A18BEE77FC
GO
Isoform 4 (identifier: Q6UXI9-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: Q → QDEHIPAPLDQGSEQPLFQPLDHQATSLPSR
     387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S

Note: No experimental confirmation available.

Show »
Length:566
Mass (Da):61,958
Checksum:iB440DC01AB4FF573
GO
Isoform 5 (identifier: Q6UXI9-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S

Note: No experimental confirmation available.

Show »
Length:536
Mass (Da):58,651
Checksum:i6DC363CBA70A8AA0
GO
Isoform 6 (identifier: Q6UXI9-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-58: P → PFYVLRQRIARIRCQLKA

Note: No experimental confirmation available.

Show »
Length:582
Mass (Da):64,023
Checksum:i256AD053250C578A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti20 – 201E → K in BAG63765. (PubMed:14702039)Curated
Sequence conflicti340 – 3401T → A in BAG65139. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti159 – 1591Q → H.1 Publication
Corresponds to variant rs35132891 [ dbSNP | Ensembl ].
VAR_033314
Natural varianti234 – 2341I → V.3 Publications
Corresponds to variant rs4340795 [ dbSNP | Ensembl ].
VAR_033315
Natural varianti473 – 4731G → S.
Corresponds to variant rs35613262 [ dbSNP | Ensembl ].
VAR_033316
Natural varianti476 – 4761M → T.
Corresponds to variant rs35488797 [ dbSNP | Ensembl ].
VAR_033317

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei58 – 581P → PFYVLRQRIARIRCQLKA in isoform 6. 1 PublicationVSP_046131
Alternative sequencei88 – 881Q → QDEHIPAPLDQGSEQPLFQP LDHQATSLPSR in isoform 3 and isoform 4. 1 PublicationVSP_045813
Alternative sequencei387 – 41630IPRQP…KDDPG → S in isoform 2, isoform 4 and isoform 5. 2 PublicationsVSP_026987Add
BLAST
Alternative sequencei535 – 56430VVFKG…HCSEE → ESQ in isoform 2. 1 PublicationVSP_026988Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY358336 mRNA. Translation: AAQ88702.1.
AK290029 mRNA. Translation: BAF82718.1.
AK295772 mRNA. Translation: BAG58596.1.
AK302477 mRNA. Translation: BAG63765.1.
AK304279 mRNA. Translation: BAG65139.1.
AK304721 mRNA. Translation: BAG65484.1.
AC093782 Genomic DNA. No translation available.
AC109361 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06196.1.
CCDSiCCDS34046.1. [Q6UXI9-1]
CCDS54784.1. [Q6UXI9-6]
CCDS54785.1. [Q6UXI9-3]
CCDS54786.1. [Q6UXI9-4]
CCDS54787.1. [Q6UXI9-5]
RefSeqiNP_001028219.1. NM_001033047.2. [Q6UXI9-1]
NP_001171619.1. NM_001184690.1. [Q6UXI9-6]
NP_001171620.1. NM_001184691.1. [Q6UXI9-3]
NP_001171621.1. NM_001184692.1. [Q6UXI9-5]
NP_001171622.1. NM_001184693.1. [Q6UXI9-4]
UniGeneiHs.518921.

Genome annotation databases

EnsembliENST00000305572; ENSP00000302557; ENSG00000168743. [Q6UXI9-2]
ENST00000379987; ENSP00000369323; ENSG00000168743. [Q6UXI9-1]
ENST00000427316; ENSP00000389252; ENSG00000168743. [Q6UXI9-3]
ENST00000453617; ENSP00000402884; ENSG00000168743. [Q6UXI9-6]
ENST00000506666; ENSP00000422474; ENSG00000168743. [Q6UXI9-4]
ENST00000514622; ENSP00000422044; ENSG00000168743. [Q6UXI9-5]
GeneIDi255743.
KEGGihsa:255743.
UCSCiuc003hya.3. human. [Q6UXI9-1]

Polymorphism databases

DMDMi311033424.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY358336 mRNA. Translation: AAQ88702.1 .
AK290029 mRNA. Translation: BAF82718.1 .
AK295772 mRNA. Translation: BAG58596.1 .
AK302477 mRNA. Translation: BAG63765.1 .
AK304279 mRNA. Translation: BAG65139.1 .
AK304721 mRNA. Translation: BAG65484.1 .
AC093782 Genomic DNA. No translation available.
AC109361 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06196.1 .
CCDSi CCDS34046.1. [Q6UXI9-1 ]
CCDS54784.1. [Q6UXI9-6 ]
CCDS54785.1. [Q6UXI9-3 ]
CCDS54786.1. [Q6UXI9-4 ]
CCDS54787.1. [Q6UXI9-5 ]
RefSeqi NP_001028219.1. NM_001033047.2. [Q6UXI9-1 ]
NP_001171619.1. NM_001184690.1. [Q6UXI9-6 ]
NP_001171620.1. NM_001184691.1. [Q6UXI9-3 ]
NP_001171621.1. NM_001184692.1. [Q6UXI9-5 ]
NP_001171622.1. NM_001184693.1. [Q6UXI9-4 ]
UniGenei Hs.518921.

3D structure databases

ProteinModelPortali Q6UXI9.
SMRi Q6UXI9. Positions 34-254, 422-562.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 129117. 1 interaction.
STRINGi 9606.ENSP00000369323.

PTM databases

PhosphoSitei Q6UXI9.

Polymorphism databases

DMDMi 311033424.

Proteomic databases

PaxDbi Q6UXI9.
PRIDEi Q6UXI9.

Protocols and materials databases

DNASUi 255743.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000305572 ; ENSP00000302557 ; ENSG00000168743 . [Q6UXI9-2 ]
ENST00000379987 ; ENSP00000369323 ; ENSG00000168743 . [Q6UXI9-1 ]
ENST00000427316 ; ENSP00000389252 ; ENSG00000168743 . [Q6UXI9-3 ]
ENST00000453617 ; ENSP00000402884 ; ENSG00000168743 . [Q6UXI9-6 ]
ENST00000506666 ; ENSP00000422474 ; ENSG00000168743 . [Q6UXI9-4 ]
ENST00000514622 ; ENSP00000422044 ; ENSG00000168743 . [Q6UXI9-5 ]
GeneIDi 255743.
KEGGi hsa:255743.
UCSCi uc003hya.3. human. [Q6UXI9-1 ]

Organism-specific databases

CTDi 255743.
GeneCardsi GC04P106816.
H-InvDB HIX0004424.
HGNCi HGNC:27405. NPNT.
HPAi HPA003711.
MIMi 610306. gene.
neXtProti NX_Q6UXI9.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG254583.
GeneTreei ENSGT00750000117321.
HOGENOMi HOG000059638.
HOVERGENi HBG108200.
InParanoidi Q6UXI9.
KOi K06824.
OrthoDBi EOG73RBB8.
PhylomeDBi Q6UXI9.
TreeFami TF330819.

Miscellaneous databases

ChiTaRSi NPNT. human.
GenomeRNAii 255743.
NextBioi 92630.
PROi Q6UXI9.
SOURCEi Search...

Gene expression databases

Bgeei Q6UXI9.
CleanExi HS_NPNT.
ExpressionAtlasi Q6UXI9. baseline and differential.
Genevestigatori Q6UXI9.

Family and domain databases

InterProi IPR013320. ConA-like_dom.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000998. MAM_dom.
[Graphical view ]
Pfami PF07645. EGF_CA. 3 hits.
PF00629. MAM. 1 hit.
[Graphical view ]
SMARTi SM00181. EGF. 3 hits.
SM00179. EGF_CA. 2 hits.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 1 hit.
SSF57184. SSF57184. 2 hits.
PROSITEi PS00010. ASX_HYDROXYL. 3 hits.
PS00022. EGF_1. 1 hit.
PS01186. EGF_2. 3 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 3 hits.
PS50060. MAM_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS HIS-159 AND VAL-234.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4; 5 AND 6), VARIANT VAL-234.
    Tissue: Hippocampus, Testis, Trachea and Uterus.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-234.
  5. "Identification and characterization of a novel human nephronectin gene in silico."
    Huang J.T.-J., Lee V.
    Int. J. Mol. Med. 15:719-724(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

Entry informationi

Entry nameiNPNT_HUMAN
AccessioniPrimary (citable) accession number: Q6UXI9
Secondary accession number(s): A6NFT9
, A8K1W4, B4DIT4, B4DYK3, B4E2H7, B4E3H2, D6RCA1, E9PCK8, E9PCQ1, E9PE64, E9PF04
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: November 2, 2010
Last modified: October 29, 2014
This is version 91 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3