Q6UXH8 (CCBE1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 65.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Collagen and calcium-binding EGF domain-containing protein 1 Alternative name(s): Full of fluid protein homolog | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 406 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis. Ref.6 |
| Subcellular location | Secreted Potential. |
| Tissue specificity | Not expressed in blood or lymphatic endothelial cells. Ref.5 |
| Involvement in disease | Defects in CCBE1 are the cause of Hennekam lymphangiectasia-lymphedema syndrome (HLLS) [MIM:235510]. HLLS is a generalized lymph-vessels dysplasia characterized by intestinal lymphangiectasia with severe lymphedema of the limbs, genitalia and face. In addition, affected individuals have unusual facies and severe mental retardation. Ref.6 Ref.7 |
| Sequence similarities | Belongs to the CCBE1 family. Contains 2 collagen-like domains. Contains 1 EGF-like domain. |
| Sequence caution | The sequence BAB85569.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Angiogenesis |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Mental retardation |
| Domain | Collagen EGF-like domain Repeat Signal |
| Ligand | Calcium |
| Molecular function | Developmental protein |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | lymphangiogenesis Inferred from mutant phenotype Ref.6. Source: UniProtKB sprouting angiogenesisInferred from sequence or structural similarity. Source: UniProtKB venous blood vessel morphogenesisInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular component | collagen Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6UXH8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6UXH8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-271: Missing. 272-305: MPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPV → MQLTWASISLVTRCWPQTPTFQDLLACLGARALP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q6UXH8-3) The sequence of this isoform differs from the canonical sequence as follows: 1-191: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 34 | 34 | Potential | ||||||||
| Chain | 35 – 406 | 372 | Collagen and calcium-binding EGF domain-containing protein 1 | PRO_0000279516 | |||||||
Regions | |||||||||||
| Domain | 134 – 175 | 42 | EGF-like; calcium-binding Potential | ||||||||
| Domain | 245 – 290 | 46 | Collagen-like 1 | ||||||||
| Domain | 300 – 333 | 34 | Collagen-like 2 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 142 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 182 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 138 ↔ 150 | By similarity | |||||||||
| Disulfide bond | 146 ↔ 159 | By similarity | |||||||||
| Disulfide bond | 161 ↔ 174 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 271 | 271 | Missing in isoform 2. | VSP_023470 | |||||||
| Alternative sequence | 1 – 191 | 191 | Missing in isoform 3. | VSP_023469 | |||||||
| Alternative sequence | 272 – 305 | 34 | MPGPP…RRGPV → MQLTWASISLVTRCWPQTPT FQDLLACLGARALP in isoform 2. | VSP_023471 | |||||||
| Natural variant | 75 | 1 | C → S in HLLS. Ref.6 Ref.7 Corresponds to variant rs121908250 [ dbSNP | Ensembl ]. | VAR_063746 | |||||||
| Natural variant | 102 | 1 | C → S in HLLS. Ref.6 Corresponds to variant rs121908251 [ dbSNP | Ensembl ]. | VAR_063747 | |||||||
| Natural variant | 158 | 1 | R → C in HLLS. Ref.6 Corresponds to variant rs121908253 [ dbSNP | Ensembl ]. | VAR_063748 | |||||||
| Natural variant | 174 | 1 | C → R in HLLS. Ref.6 Corresponds to variant rs121908254 [ dbSNP | Ensembl ]. | VAR_063749 | |||||||
| Natural variant | 193 | 1 | V → G. Corresponds to variant rs11659589 [ dbSNP | Ensembl ]. | VAR_048971 | |||||||
| Natural variant | 327 | 1 | G → R in HLLS; rs121908252. Ref.6 | VAR_063750 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins." Nagase T., Kikuno R., Ohara O. DNA Res. 8:319-327(2001) [PubMed: 11853319] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Fetal brain. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Lung. |
| [5] | "ccbe1 is required for embryonic lymphangiogenesis and venous sprouting." Hogan B.M., Bos F.L., Bussmann J., Witte M., Chi N.C., Duckers H.J., Schulte-Merker S. Nat. Genet. 41:396-398(2009) [PubMed: 19287381] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [6] | "Mutations in CCBE1 cause generalized lymph vessel dysplasia in humans." Alders M., Hogan B.M., Gjini E., Salehi F., Al-Gazali L., Hennekam E.A., Holmberg E.E., Mannens M.M., Mulder M.F., Offerhaus G.J., Prescott T.E., Schroor E.J., Verheij J.B., Witte M., Zwijnenburg P.J., Vikkula M., Schulte-Merker S., Hennekam R.C. Nat. Genet. 41:1272-1274(2009) [PubMed: 19935664] [Abstract] Cited for: FUNCTION, VARIANTS HLLS SER-75; SER-102; CYS-158; ARG-174 AND ARG-327. |
| [7] | "Linkage and sequence analysis indicate that CCBE1 is mutated in recessively inherited generalised lymphatic dysplasia." Connell F., Kalidas K., Ostergaard P., Brice G., Homfray T., Roberts L., Bunyan D.J., Mitton S., Mansour S., Mortimer P., Jeffery S. Hum. Genet. 127:231-241(2010) [PubMed: 19911200] [Abstract] Cited for: VARIANT HLLS SER-75. |
| [8] | Erratum Connell F., Kalidas K., Ostergaard P., Brice G., Homfray T., Roberts L., Bunyan D.J., Mitton S., Mansour S., Mortimer P., Jeffery S. Hum. Genet. 127:243-243(2010) |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB075863 mRNA. Translation: BAB85569.1. Different initiation. AY358347 mRNA. Translation: AAQ88713.1. BX640826 mRNA. Translation: CAE45902.1. BC046645 mRNA. Translation: AAH46645.1. |
| IPI | IPI00152815. IPI00830026. IPI00830123. |
| RefSeq | NP_597716.1. NM_133459.3. |
| UniGene | Hs.34333. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1APQ based on UniProtKB P00736. |
| ProteinModelPortal | Q6UXH8. |
| SMR | Q6UXH8. Positions 3-209, 256-289, 291-325. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6UXH8. 2 interactions. |
| STRING | Q6UXH8. |
Polymorphism databases | |
| DMDM | 74738220. |
Proteomic databases | |
| PRIDE | Q6UXH8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000439986; ENSP00000404464; ENSG00000183287. |
| GeneID | 147372. |
| KEGG | hsa:147372. |
| UCSC | uc002lia.1. human. uc002lib.1. human. uc010dpq.1. human. |
Organism-specific databases | |
| CTD | 147372. |
| GeneCards | GC18M057101. |
| H-InvDB | HIX0014484. |
| HGNC | HGNC:29426. CCBE1. |
| HPA | HPA041361. HPA041374. |
| MIM | 235510. phenotype. 612753. gene. |
| neXtProt | NX_Q6UXH8. |
| Orphanet | 2136. Hennekam syndrome. |
| PharmGKB | PA134880094. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG19527. |
| GeneTree | ENSGT00390000014907. |
| HOGENOM | HBG443891. |
| HOVERGEN | HBG081035. |
| InParanoid | Q6UXH8. |
| OMA | YPNDTGH. |
| OrthoDB | EOG44BB30. |
| PhylomeDB | Q6UXH8. |
Gene expression databases | |
| ArrayExpress | Q6UXH8. |
| Bgee | Q6UXH8. |
| CleanEx | HS_CCBE1. |
| Genevestigator | Q6UXH8. |
Family and domain databases | |
| InterPro | IPR008160. Collagen. IPR006210. EGF-like. IPR001881. EGF-like_Ca-bd. IPR013032. EGF-like_reg_CS. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR000742. EGF_3. IPR018097. EGF_Ca-bd_CS. [Graphical view] |
| Pfam | PF01391. Collagen. 2 hits. PF07645. EGF_CA. 1 hit. [Graphical view] |
| SMART | SM00181. EGF. 1 hit. SM00179. EGF_CA. 1 hit. [Graphical view] |
| PROSITE | PS00010. ASX_HYDROXYL. 1 hit. PS00022. EGF_1. False negative. PS01186. EGF_2. 1 hit. PS50026. EGF_3. 1 hit. PS01187. EGF_CA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 85596. |
| SOURCE | Search... |
Entry information
| Entry name | CCBE1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6UXH8 Secondary accession number(s): Q6MZX5, Q86SS2, Q8TF19 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with