Reviewed,
UniProtKB/Swiss-Prot Q6UXH8 (CCBE1_HUMAN)
Last modified
November 24, 2009.
Version 45.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Collagen and calcium-binding EGF domain-containing protein 1 Alternative name(s): Full of fluid protein homolog | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 406 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis By similarity. |
| Subcellular location | Secreted Potential. |
| Tissue specificity | Not expressed in blood or lymphatic endothelial cells. Ref.5 |
| Sequence similarities | Belongs to the CCBE1 family. Contains 2 collagen-like domains. Contains 1 EGF-like domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Angiogenesis |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Collagen EGF-like domain Repeat Signal |
| Ligand | Calcium |
| Molecular function | Developmental protein |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | lymphangiogenesis Inferred from sequence or structural similarity. Source: UniProtKB sprouting angiogenesisInferred from sequence or structural similarity. Source: UniProtKB venous blood vessel morphogenesisInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6UXH8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6UXH8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-271: Missing. 272-305: MPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPV → MQLTWASISLVTRCWPQTPTFQDLLACLGARALP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q6UXH8-3) The sequence of this isoform differs from the canonical sequence as follows: 1-191: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 34 | 34 | Potential | ||||||||
| Chain | 35 – 406 | 372 | Collagen and calcium-binding EGF domain-containing protein 1 | PRO_0000279516 | |||||||
Regions | |||||||||||
| Domain | 134 – 175 | 42 | EGF-like; calcium-binding Potential | ||||||||
| Domain | 245 – 290 | 46 | Collagen-like 1 | ||||||||
| Domain | 300 – 333 | 34 | Collagen-like 2 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 142 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 182 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 138 ↔ 150 | By similarity | |||||||||
| Disulfide bond | 146 ↔ 159 | By similarity | |||||||||
| Disulfide bond | 161 ↔ 174 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 271 | 271 | Missing in isoform 2. | VSP_023470 | |||||||
| Alternative sequence | 1 – 191 | 191 | Missing in isoform 3. | VSP_023469 | |||||||
| Alternative sequence | 272 – 305 | 34 | MPGPP…RRGPV → MQLTWASISLVTRCWPQTPT FQDLLACLGARALP in isoform 2. | VSP_023471 | |||||||
| Natural variant | 193 | 1 | V → G: dbSNP rs11659589. | VAR_048971 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins." Nagase T., Kikuno R., Ohara O. DNA Res. 8:319-327(2001) [PubMed: 11853319] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Fetal brain. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Lung. |
| [5] | "ccbe1 is required for embryonic lymphangiogenesis and venous sprouting." Hogan B.M., Bos F.L., Bussmann J., Witte M., Chi N.C., Duckers H.J., Schulte-Merker S. Nat. Genet. 41:396-398(2009) [PubMed: 19287381] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AB075863 mRNA. Translation: BAB85569.1. Different initiation. AY358347 mRNA. Translation: AAQ88713.1. BX640826 mRNA. Translation: CAE45902.1. BC046645 mRNA. Translation: AAH46645.1. | |
| IPI | IPI00152815. IPI00830026. IPI00830123. |
| RefSeq | NP_597716.1. |
| UniGene | Hs.34333 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1APQ based on UniProtKB P00736. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q6UXH8. |
Proteomic databases | |
| PRIDE | Q6UXH8. |
Genome annotation databases | |
| Ensembl | ENST00000439986; ENSP00000404464; ENSG00000183287; Homo sapiens. [Genome view] |
| GeneID | 147372. |
| KEGG | hsa:147372. |
| UCSC | uc002lia.1. human. uc002lib.1. human. uc010dpq.1. human. |
Organism-specific databases | |
| CTD | 147372. |
| GeneCards | GC18M055253. |
| HGNC | HGNC:29426. CCBE1. |
| PharmGKB | PA134880094. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q6UXH8. |
| OMA | YPNDTGH |
Gene expression databases | |
| ArrayExpress | Q6UXH8. |
| Bgee | Q6UXH8. |
| CleanEx | HS_CCBE1. |
| Genevestigator | Q6UXH8. |
Family and domain databases | |
| InterPro | IPR008160. Collagen. IPR006210. EGF-like. IPR013032. EGF-like_reg_CS. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR000742. EGF_3. IPR001881. EGF_Ca_bd. IPR013091. EGF_Ca_bd_2. IPR018097. EGF_Ca_bd_CS. [Graphical view] |
| Pfam | PF01391. Collagen. 2 hits. PF07645. EGF_CA. 1 hit. [Graphical view] |
| SMART | SM00181. EGF. 1 hit. SM00179. EGF_CA. 1 hit. [Graphical view] |
| PROSITE | PS00010. ASX_HYDROXYL. 1 hit. PS00022. EGF_1. False negative. PS01186. EGF_2. 1 hit. PS50026. EGF_3. 1 hit. PS01187. EGF_CA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 85596. |
Entry information
| Entry name | CCBE1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6UXH8 Secondary accession number(s): Q6MZX5, Q86SS2, Q8TF19 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with


