Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6UXH1

- CREL2_HUMAN

UniProt

Q6UXH1 - CREL2_HUMAN

Protein

Cysteine-rich with EGF-like domain protein 2

Gene

CRELD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 94 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May regulate transport of alpha4-beta2 neuronal acetylcholine receptor.

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. protein binding Source: IntAct

    Keywords - Ligandi

    Calcium

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cysteine-rich with EGF-like domain protein 2
    Gene namesi
    Name:CRELD2
    ORF Names:UNQ185/PRO211
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 22

    Organism-specific databases

    HGNCiHGNC:28150. CRELD2.

    Subcellular locationi

    Secreted Curated. Endoplasmic reticulum 1 Publication

    GO - Cellular componenti

    1. endoplasmic reticulum Source: UniProtKB-SubCell
    2. extracellular space Source: Ensembl
    3. Golgi apparatus Source: Ensembl

    Keywords - Cellular componenti

    Endoplasmic reticulum, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672079.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 24241 PublicationAdd
    BLAST
    Chaini25 – 353329Cysteine-rich with EGF-like domain protein 2PRO_0000256244Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi140 ↔ 154PROSITE-ProRule annotation
    Disulfide bondi148 ↔ 166PROSITE-ProRule annotation
    Disulfide bondi168 ↔ 177PROSITE-ProRule annotation
    Glycosylationi251 – 2511N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi294 ↔ 308PROSITE-ProRule annotation
    Disulfide bondi301 ↔ 317PROSITE-ProRule annotation
    Disulfide bondi319 ↔ 330PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ6UXH1.
    PaxDbiQ6UXH1.
    PRIDEiQ6UXH1.

    PTM databases

    PhosphoSiteiQ6UXH1.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed.2 Publications

    Developmental stagei

    Expressed in all fetal tissues tested.1 Publication

    Gene expression databases

    ArrayExpressiQ6UXH1.
    BgeeiQ6UXH1.
    CleanExiHS_CRELD2.
    GenevestigatoriQ6UXH1.

    Organism-specific databases

    HPAiCAB025604.
    HPA000603.

    Interactioni

    Subunit structurei

    May interact with CHRNA4.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CDKN2AP427712EBI-3935314,EBI-375053

    Protein-protein interaction databases

    BioGridi122591. 5 interactions.
    IntActiQ6UXH1. 28 interactions.
    MINTiMINT-4827922.
    STRINGi9606.ENSP00000383938.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6UXH1.
    SMRiQ6UXH1. Positions 120-185, 229-324.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini136 – 17843EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Repeati193 – 24048FU 1Add
    BLAST
    Repeati253 – 30250FU 2Add
    BLAST
    Domaini290 – 33142EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the CRELD family.Curated
    Contains 2 EGF-like domains.PROSITE-ProRule annotation
    Contains 2 FU (furin-like) repeats.Curated

    Keywords - Domaini

    EGF-like domain, Repeat, Signal

    Phylogenomic databases

    eggNOGiNOG315654.
    HOVERGENiHBG081344.
    OMAiTCVGCTG.
    PhylomeDBiQ6UXH1.
    TreeFamiTF316507.

    Family and domain databases

    InterProiIPR021852. DUF3456.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR002049. EGF_laminin.
    IPR006212. Furin_repeat.
    IPR009030. Growth_fac_rcpt_N_dom.
    [Graphical view]
    PfamiPF11938. DUF3456. 2 hits.
    PF07645. EGF_CA. 1 hit.
    [Graphical view]
    SMARTiSM00181. EGF. 1 hit.
    SM00179. EGF_CA. 1 hit.
    SM00261. FU. 2 hits.
    [Graphical view]
    SUPFAMiSSF57184. SSF57184. 1 hit.
    PROSITEiPS00010. ASX_HYDROXYL. 1 hit.
    PS00022. EGF_1. 1 hit.
    PS01186. EGF_2. 2 hits.
    PS50026. EGF_3. 2 hits.
    PS01187. EGF_CA. 2 hits.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6UXH1-1) [UniParc]FASTAAdd to Basket

    Also known as: Delta

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRLPRRAALG LLPLLLLLPP APEAAKKPTP CHRCRGLVDK FNQGMVDTAK    50
    KNFGGGNTAW EEKTLSKYES SEIRLLEILE GLCESSDFEC NQMLEAQEEH 100
    LEAWWLQLKS EYPDLFEWFC VKTLKVCCSP GTYGPDCLAC QGGSQRPCSG 150
    NGHCSGDGSR QGDGSCRCHM GYQGPLCTDC MDGYFSSLRN ETHSICTACD 200
    ESCKTCSGLT NRDCGECEVG WVLDEGACVD VDECAAEPPP CSAAQFCKNA 250
    NGSYTCEECD SSCVGCTGEG PGNCKECISG YAREHGQCAD VDECSLAEKT 300
    CVRKNENCYN TPGSYVCVCP DGFEETEDAC VPPAEAEATE GESPTQLPSR 350
    EDL 353
    Length:353
    Mass (Da):38,192
    Last modified:July 5, 2004 - v1
    Checksum:iED8C635DD74E768D
    GO
    Isoform 2 (identifier: Q6UXH1-2) [UniParc]FASTAAdd to Basket

    Also known as: Alpha

    The sequence of this isoform differs from the canonical sequence as follows:
         258-289: Missing.

    Show »
    Length:321
    Mass (Da):34,958
    Checksum:iA74360A1D817F23D
    GO
    Isoform 3 (identifier: Q6UXH1-3) [UniParc]FASTAAdd to Basket

    Also known as: Beta

    The sequence of this isoform differs from the canonical sequence as follows:
         258-284: ECDSSCVGCTGEGPGNCKECISGYARE → GGPGGRVCTPGPAGFRCCLCQHSFMAS
         285-353: Missing.

    Note: Minor isoform.

    Show »
    Length:284
    Mass (Da):30,712
    Checksum:i8C1CE8AA274D2EE4
    GO
    Isoform 4 (identifier: Q6UXH1-4) [UniParc]FASTAAdd to Basket

    Also known as: Gamma

    The sequence of this isoform differs from the canonical sequence as follows:
         230-257: Missing.

    Show »
    Length:325
    Mass (Da):35,288
    Checksum:iD5C35D6D12530499
    GO
    Isoform 5 (identifier: Q6UXH1-5) [UniParc]FASTAAdd to Basket

    Also known as: Epsilon

    The sequence of this isoform differs from the canonical sequence as follows:
         197-197: T → TVRTGLSDSYPPCCLSLGCWRGVGHAWIRGRNTHTQPGYSSRVWIAAFSP

    Show »
    Length:402
    Mass (Da):43,579
    Checksum:i4BCFF7D3656A24A9
    GO
    Isoform 6 (identifier: Q6UXH1-6) [UniParc]FASTAAdd to Basket

    Also known as: Zeta

    The sequence of this isoform differs from the canonical sequence as follows:
         337-353: EATEGESPTQLPSREDL → GEWHGCPPHRLPSPGPQGLHVDWLLGLKSTQMVALRW

    Show »
    Length:373
    Mass (Da):40,491
    Checksum:i4DD38359F3EEBC19
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti182 – 1821D → E.
    Corresponds to variant rs8139422 [ dbSNP | Ensembl ].
    VAR_028892
    Natural varianti295 – 2951S → A.1 Publication
    Corresponds to variant rs11545762 [ dbSNP | Ensembl ].
    VAR_028893
    Natural varianti325 – 3251E → G.1 Publication
    Corresponds to variant rs11545763 [ dbSNP | Ensembl ].
    VAR_028894

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei197 – 1971T → TVRTGLSDSYPPCCLSLGCW RGVGHAWIRGRNTHTQPGYS SRVWIAAFSP in isoform 5. 1 PublicationVSP_021339
    Alternative sequencei230 – 25728Missing in isoform 4. 1 PublicationVSP_021340Add
    BLAST
    Alternative sequencei258 – 28932Missing in isoform 2. 2 PublicationsVSP_021341Add
    BLAST
    Alternative sequencei258 – 28427ECDSS…GYARE → GGPGGRVCTPGPAGFRCCLC QHSFMAS in isoform 3. 1 PublicationVSP_021342Add
    BLAST
    Alternative sequencei285 – 35369Missing in isoform 3. 1 PublicationVSP_021343Add
    BLAST
    Alternative sequencei337 – 35317EATEG…SREDL → GEWHGCPPHRLPSPGPQGLH VDWLLGLKSTQMVALRW in isoform 6. 1 PublicationVSP_021344Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ968414 mRNA. Translation: CAI91316.1.
    DQ470676 mRNA. Translation: ABF06668.1.
    DQ470677 mRNA. Translation: ABF06669.1.
    DQ470678 mRNA. Translation: ABF06670.1.
    DQ470679 mRNA. Translation: ABF06671.1.
    DQ470680 mRNA. Translation: ABF06672.1.
    AY358355 mRNA. Translation: AAQ88721.1.
    AL671710 Genomic DNA. Translation: CAO72066.1.
    AL671710 Genomic DNA. Translation: CAO72067.1.
    AL671710 Genomic DNA. Translation: CAO72068.1.
    AL671710 Genomic DNA. Translation: CAO72069.1.
    CH471138 Genomic DNA. Translation: EAW73483.1.
    CH471138 Genomic DNA. Translation: EAW73484.1.
    BC002894 mRNA. Translation: AAH02894.1.
    BC050675 mRNA. Translation: AAH50675.1.
    CCDSiCCDS14082.1. [Q6UXH1-1]
    CCDS46730.1. [Q6UXH1-5]
    CCDS63515.1. [Q6UXH1-2]
    CCDS63516.1. [Q6UXH1-4]
    RefSeqiNP_001128573.1. NM_001135101.2. [Q6UXH1-5]
    NP_001271246.1. NM_001284317.1. [Q6UXH1-4]
    NP_001271247.1. NM_001284318.1. [Q6UXH1-2]
    NP_077300.3. NM_024324.4. [Q6UXH1-1]
    XP_005261795.1. XM_005261738.2. [Q6UXH1-6]
    UniGeneiHs.211282.

    Genome annotation databases

    EnsembliENST00000328268; ENSP00000332223; ENSG00000184164. [Q6UXH1-1]
    ENST00000403427; ENSP00000384111; ENSG00000184164. [Q6UXH1-4]
    ENST00000404488; ENSP00000383938; ENSG00000184164. [Q6UXH1-5]
    ENST00000407217; ENSP00000386034; ENSG00000184164. [Q6UXH1-2]
    GeneIDi79174.
    KEGGihsa:79174.
    UCSCiuc003biz.3. human. [Q6UXH1-3]
    uc003bja.2. human. [Q6UXH1-1]
    uc010haj.3. human. [Q6UXH1-6]
    uc010hak.2. human. [Q6UXH1-4]
    uc010hal.2. human. [Q6UXH1-5]
    uc010ham.2. human. [Q6UXH1-2]

    Polymorphism databases

    DMDMi74738218.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ968414 mRNA. Translation: CAI91316.1 .
    DQ470676 mRNA. Translation: ABF06668.1 .
    DQ470677 mRNA. Translation: ABF06669.1 .
    DQ470678 mRNA. Translation: ABF06670.1 .
    DQ470679 mRNA. Translation: ABF06671.1 .
    DQ470680 mRNA. Translation: ABF06672.1 .
    AY358355 mRNA. Translation: AAQ88721.1 .
    AL671710 Genomic DNA. Translation: CAO72066.1 .
    AL671710 Genomic DNA. Translation: CAO72067.1 .
    AL671710 Genomic DNA. Translation: CAO72068.1 .
    AL671710 Genomic DNA. Translation: CAO72069.1 .
    CH471138 Genomic DNA. Translation: EAW73483.1 .
    CH471138 Genomic DNA. Translation: EAW73484.1 .
    BC002894 mRNA. Translation: AAH02894.1 .
    BC050675 mRNA. Translation: AAH50675.1 .
    CCDSi CCDS14082.1. [Q6UXH1-1 ]
    CCDS46730.1. [Q6UXH1-5 ]
    CCDS63515.1. [Q6UXH1-2 ]
    CCDS63516.1. [Q6UXH1-4 ]
    RefSeqi NP_001128573.1. NM_001135101.2. [Q6UXH1-5 ]
    NP_001271246.1. NM_001284317.1. [Q6UXH1-4 ]
    NP_001271247.1. NM_001284318.1. [Q6UXH1-2 ]
    NP_077300.3. NM_024324.4. [Q6UXH1-1 ]
    XP_005261795.1. XM_005261738.2. [Q6UXH1-6 ]
    UniGenei Hs.211282.

    3D structure databases

    ProteinModelPortali Q6UXH1.
    SMRi Q6UXH1. Positions 120-185, 229-324.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122591. 5 interactions.
    IntActi Q6UXH1. 28 interactions.
    MINTi MINT-4827922.
    STRINGi 9606.ENSP00000383938.

    PTM databases

    PhosphoSitei Q6UXH1.

    Polymorphism databases

    DMDMi 74738218.

    Proteomic databases

    MaxQBi Q6UXH1.
    PaxDbi Q6UXH1.
    PRIDEi Q6UXH1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000328268 ; ENSP00000332223 ; ENSG00000184164 . [Q6UXH1-1 ]
    ENST00000403427 ; ENSP00000384111 ; ENSG00000184164 . [Q6UXH1-4 ]
    ENST00000404488 ; ENSP00000383938 ; ENSG00000184164 . [Q6UXH1-5 ]
    ENST00000407217 ; ENSP00000386034 ; ENSG00000184164 . [Q6UXH1-2 ]
    GeneIDi 79174.
    KEGGi hsa:79174.
    UCSCi uc003biz.3. human. [Q6UXH1-3 ]
    uc003bja.2. human. [Q6UXH1-1 ]
    uc010haj.3. human. [Q6UXH1-6 ]
    uc010hak.2. human. [Q6UXH1-4 ]
    uc010hal.2. human. [Q6UXH1-5 ]
    uc010ham.2. human. [Q6UXH1-2 ]

    Organism-specific databases

    CTDi 79174.
    GeneCardsi GC22P050311.
    H-InvDB HIX0018450.
    HGNCi HGNC:28150. CRELD2.
    HPAi CAB025604.
    HPA000603.
    MIMi 607171. gene.
    neXtProti NX_Q6UXH1.
    PharmGKBi PA142672079.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG315654.
    HOVERGENi HBG081344.
    OMAi TCVGCTG.
    PhylomeDBi Q6UXH1.
    TreeFami TF316507.

    Miscellaneous databases

    ChiTaRSi CRELD2. human.
    GeneWikii CRELD2.
    GenomeRNAii 79174.
    NextBioi 68145.
    PROi Q6UXH1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6UXH1.
    Bgeei Q6UXH1.
    CleanExi HS_CRELD2.
    Genevestigatori Q6UXH1.

    Family and domain databases

    InterProi IPR021852. DUF3456.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR002049. EGF_laminin.
    IPR006212. Furin_repeat.
    IPR009030. Growth_fac_rcpt_N_dom.
    [Graphical view ]
    Pfami PF11938. DUF3456. 2 hits.
    PF07645. EGF_CA. 1 hit.
    [Graphical view ]
    SMARTi SM00181. EGF. 1 hit.
    SM00179. EGF_CA. 1 hit.
    SM00261. FU. 2 hits.
    [Graphical view ]
    SUPFAMi SSF57184. SSF57184. 1 hit.
    PROSITEi PS00010. ASX_HYDROXYL. 1 hit.
    PS00022. EGF_1. 1 hit.
    PS01186. EGF_2. 2 hits.
    PS50026. EGF_3. 2 hits.
    PS01187. EGF_CA. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The cysteine-rich with EGF-like domains 2 (CRELD2) protein interacts with the large cytoplasmic domain of human neuronal nicotinic acetylcholine receptor alpha4 and beta2 subunits."
      Ortiz J.A., Castillo M., Dominguez del Toro E., Mulet J., Gerber S., Valor L.M., Sala S., Sala F., Gutierrez L.M., Criado M.
      J. Neurochem. 95:1585-1596(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH CHRNA4.
      Tissue: Brain.
    2. "CRELD2: gene mapping, alternate splicing, and comparative genomic identification of the promoter region."
      Maslen C.L., Babcock D., Redig J.K., Kapeli K., Akkari Y.M., Olson S.B.
      Gene 382:111-120(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4; 5 AND 6), ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5 AND 6), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "The DNA sequence of human chromosome 22."
      Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
      , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
      Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS ALA-295 AND GLY-325.
      Tissue: Lung carcinoma and Pancreatic carcinoma.
    7. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
      Zhang Z., Henzel W.J.
      Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 25-39.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiCREL2_HUMAN
    AccessioniPrimary (citable) accession number: Q6UXH1
    Secondary accession number(s): A5GZA2
    , A5GZA3, A5GZA4, A5GZA5, A5GZA6, Q4W0V0, Q86UC0, Q9BU47
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 31, 2006
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 94 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 22
      Human chromosome 22: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3