Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6UXH1

- CREL2_HUMAN

UniProt

Q6UXH1 - CREL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cysteine-rich with EGF-like domain protein 2

Gene

CRELD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May regulate transport of alpha4-beta2 neuronal acetylcholine receptor.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Cysteine-rich with EGF-like domain protein 2
Gene namesi
Name:CRELD2
ORF Names:UNQ185/PRO211
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 22

Organism-specific databases

HGNCiHGNC:28150. CRELD2.

Subcellular locationi

Secreted Curated. Endoplasmic reticulum 1 Publication

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-KW
  2. extracellular space Source: Ensembl
  3. Golgi apparatus Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672079.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 24241 PublicationAdd
BLAST
Chaini25 – 353329Cysteine-rich with EGF-like domain protein 2PRO_0000256244Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi140 ↔ 154PROSITE-ProRule annotation
Disulfide bondi148 ↔ 166PROSITE-ProRule annotation
Disulfide bondi168 ↔ 177PROSITE-ProRule annotation
Glycosylationi251 – 2511N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi294 ↔ 308PROSITE-ProRule annotation
Disulfide bondi301 ↔ 317PROSITE-ProRule annotation
Disulfide bondi319 ↔ 330PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ6UXH1.
PaxDbiQ6UXH1.
PRIDEiQ6UXH1.

PTM databases

PhosphoSiteiQ6UXH1.

Expressioni

Tissue specificityi

Ubiquitously expressed.2 Publications

Developmental stagei

Expressed in all fetal tissues tested.1 Publication

Gene expression databases

BgeeiQ6UXH1.
CleanExiHS_CRELD2.
ExpressionAtlasiQ6UXH1. baseline and differential.
GenevestigatoriQ6UXH1.

Organism-specific databases

HPAiCAB025604.
HPA000603.

Interactioni

Subunit structurei

May interact with CHRNA4.

Binary interactionsi

WithEntry#Exp.IntActNotes
CDKN2AP427712EBI-3935314,EBI-375053

Protein-protein interaction databases

BioGridi122591. 10 interactions.
IntActiQ6UXH1. 28 interactions.
MINTiMINT-4827922.
STRINGi9606.ENSP00000383938.

Structurei

3D structure databases

ProteinModelPortaliQ6UXH1.
SMRiQ6UXH1. Positions 113-182, 289-326.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini136 – 17843EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Repeati193 – 24048FU 1Add
BLAST
Repeati253 – 30250FU 2Add
BLAST
Domaini290 – 33142EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the CRELD family.Curated
Contains 2 EGF-like domains.PROSITE-ProRule annotation
Contains 2 FU (furin-like) repeats.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG315654.
GeneTreeiENSGT00680000100014.
HOVERGENiHBG081344.
InParanoidiQ6UXH1.
OMAiTCVGCTG.
PhylomeDBiQ6UXH1.
TreeFamiTF316507.

Family and domain databases

InterProiIPR021852. DUF3456.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR002049. EGF_laminin.
IPR006212. Furin_repeat.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view]
PfamiPF11938. DUF3456. 2 hits.
PF07645. EGF_CA. 1 hit.
[Graphical view]
SMARTiSM00181. EGF. 1 hit.
SM00179. EGF_CA. 1 hit.
SM00261. FU. 2 hits.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 1 hit.
PROSITEiPS00010. ASX_HYDROXYL. 1 hit.
PS00022. EGF_1. 1 hit.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 2 hits.
PS01187. EGF_CA. 2 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6UXH1) [UniParc]FASTAAdd to Basket

Also known as: Delta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLPRRAALG LLPLLLLLPP APEAAKKPTP CHRCRGLVDK FNQGMVDTAK
60 70 80 90 100
KNFGGGNTAW EEKTLSKYES SEIRLLEILE GLCESSDFEC NQMLEAQEEH
110 120 130 140 150
LEAWWLQLKS EYPDLFEWFC VKTLKVCCSP GTYGPDCLAC QGGSQRPCSG
160 170 180 190 200
NGHCSGDGSR QGDGSCRCHM GYQGPLCTDC MDGYFSSLRN ETHSICTACD
210 220 230 240 250
ESCKTCSGLT NRDCGECEVG WVLDEGACVD VDECAAEPPP CSAAQFCKNA
260 270 280 290 300
NGSYTCEECD SSCVGCTGEG PGNCKECISG YAREHGQCAD VDECSLAEKT
310 320 330 340 350
CVRKNENCYN TPGSYVCVCP DGFEETEDAC VPPAEAEATE GESPTQLPSR

EDL
Length:353
Mass (Da):38,192
Last modified:July 5, 2004 - v1
Checksum:iED8C635DD74E768D
GO
Isoform 2 (identifier: Q6UXH1-2) [UniParc]FASTAAdd to Basket

Also known as: Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     258-289: Missing.

Show »
Length:321
Mass (Da):34,958
Checksum:iA74360A1D817F23D
GO
Isoform 3 (identifier: Q6UXH1-3) [UniParc]FASTAAdd to Basket

Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     258-284: ECDSSCVGCTGEGPGNCKECISGYARE → GGPGGRVCTPGPAGFRCCLCQHSFMAS
     285-353: Missing.

Note: Minor isoform.

Show »
Length:284
Mass (Da):30,712
Checksum:i8C1CE8AA274D2EE4
GO
Isoform 4 (identifier: Q6UXH1-4) [UniParc]FASTAAdd to Basket

Also known as: Gamma

The sequence of this isoform differs from the canonical sequence as follows:
     230-257: Missing.

Show »
Length:325
Mass (Da):35,288
Checksum:iD5C35D6D12530499
GO
Isoform 5 (identifier: Q6UXH1-5) [UniParc]FASTAAdd to Basket

Also known as: Epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     197-197: T → TVRTGLSDSYPPCCLSLGCWRGVGHAWIRGRNTHTQPGYSSRVWIAAFSP

Show »
Length:402
Mass (Da):43,579
Checksum:i4BCFF7D3656A24A9
GO
Isoform 6 (identifier: Q6UXH1-6) [UniParc]FASTAAdd to Basket

Also known as: Zeta

The sequence of this isoform differs from the canonical sequence as follows:
     337-353: EATEGESPTQLPSREDL → GEWHGCPPHRLPSPGPQGLHVDWLLGLKSTQMVALRW

Show »
Length:373
Mass (Da):40,491
Checksum:i4DD38359F3EEBC19
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti182 – 1821D → E.
Corresponds to variant rs8139422 [ dbSNP | Ensembl ].
VAR_028892
Natural varianti295 – 2951S → A.1 Publication
Corresponds to variant rs11545762 [ dbSNP | Ensembl ].
VAR_028893
Natural varianti325 – 3251E → G.1 Publication
Corresponds to variant rs11545763 [ dbSNP | Ensembl ].
VAR_028894

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei197 – 1971T → TVRTGLSDSYPPCCLSLGCW RGVGHAWIRGRNTHTQPGYS SRVWIAAFSP in isoform 5. 1 PublicationVSP_021339
Alternative sequencei230 – 25728Missing in isoform 4. 1 PublicationVSP_021340Add
BLAST
Alternative sequencei258 – 28932Missing in isoform 2. 2 PublicationsVSP_021341Add
BLAST
Alternative sequencei258 – 28427ECDSS…GYARE → GGPGGRVCTPGPAGFRCCLC QHSFMAS in isoform 3. 1 PublicationVSP_021342Add
BLAST
Alternative sequencei285 – 35369Missing in isoform 3. 1 PublicationVSP_021343Add
BLAST
Alternative sequencei337 – 35317EATEG…SREDL → GEWHGCPPHRLPSPGPQGLH VDWLLGLKSTQMVALRW in isoform 6. 1 PublicationVSP_021344Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ968414 mRNA. Translation: CAI91316.1.
DQ470676 mRNA. Translation: ABF06668.1.
DQ470677 mRNA. Translation: ABF06669.1.
DQ470678 mRNA. Translation: ABF06670.1.
DQ470679 mRNA. Translation: ABF06671.1.
DQ470680 mRNA. Translation: ABF06672.1.
AY358355 mRNA. Translation: AAQ88721.1.
AL671710 Genomic DNA. Translation: CAO72066.1.
AL671710 Genomic DNA. Translation: CAO72067.1.
AL671710 Genomic DNA. Translation: CAO72068.1.
AL671710 Genomic DNA. Translation: CAO72069.1.
CH471138 Genomic DNA. Translation: EAW73483.1.
CH471138 Genomic DNA. Translation: EAW73484.1.
BC002894 mRNA. Translation: AAH02894.1.
BC050675 mRNA. Translation: AAH50675.1.
CCDSiCCDS14082.1. [Q6UXH1-1]
CCDS46730.1. [Q6UXH1-5]
CCDS63515.1. [Q6UXH1-2]
CCDS63516.1. [Q6UXH1-4]
RefSeqiNP_001128573.1. NM_001135101.2. [Q6UXH1-5]
NP_001271246.1. NM_001284317.1. [Q6UXH1-4]
NP_001271247.1. NM_001284318.1. [Q6UXH1-2]
NP_077300.3. NM_024324.4. [Q6UXH1-1]
XP_005261795.1. XM_005261738.2. [Q6UXH1-6]
UniGeneiHs.211282.

Genome annotation databases

EnsembliENST00000328268; ENSP00000332223; ENSG00000184164. [Q6UXH1-1]
ENST00000403427; ENSP00000384111; ENSG00000184164. [Q6UXH1-4]
ENST00000404488; ENSP00000383938; ENSG00000184164. [Q6UXH1-5]
ENST00000407217; ENSP00000386034; ENSG00000184164. [Q6UXH1-2]
GeneIDi79174.
KEGGihsa:79174.
UCSCiuc003biz.3. human. [Q6UXH1-3]
uc003bja.2. human. [Q6UXH1-1]
uc010haj.3. human. [Q6UXH1-6]
uc010hak.2. human. [Q6UXH1-4]
uc010hal.2. human. [Q6UXH1-5]
uc010ham.2. human. [Q6UXH1-2]

Polymorphism databases

DMDMi74738218.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ968414 mRNA. Translation: CAI91316.1 .
DQ470676 mRNA. Translation: ABF06668.1 .
DQ470677 mRNA. Translation: ABF06669.1 .
DQ470678 mRNA. Translation: ABF06670.1 .
DQ470679 mRNA. Translation: ABF06671.1 .
DQ470680 mRNA. Translation: ABF06672.1 .
AY358355 mRNA. Translation: AAQ88721.1 .
AL671710 Genomic DNA. Translation: CAO72066.1 .
AL671710 Genomic DNA. Translation: CAO72067.1 .
AL671710 Genomic DNA. Translation: CAO72068.1 .
AL671710 Genomic DNA. Translation: CAO72069.1 .
CH471138 Genomic DNA. Translation: EAW73483.1 .
CH471138 Genomic DNA. Translation: EAW73484.1 .
BC002894 mRNA. Translation: AAH02894.1 .
BC050675 mRNA. Translation: AAH50675.1 .
CCDSi CCDS14082.1. [Q6UXH1-1 ]
CCDS46730.1. [Q6UXH1-5 ]
CCDS63515.1. [Q6UXH1-2 ]
CCDS63516.1. [Q6UXH1-4 ]
RefSeqi NP_001128573.1. NM_001135101.2. [Q6UXH1-5 ]
NP_001271246.1. NM_001284317.1. [Q6UXH1-4 ]
NP_001271247.1. NM_001284318.1. [Q6UXH1-2 ]
NP_077300.3. NM_024324.4. [Q6UXH1-1 ]
XP_005261795.1. XM_005261738.2. [Q6UXH1-6 ]
UniGenei Hs.211282.

3D structure databases

ProteinModelPortali Q6UXH1.
SMRi Q6UXH1. Positions 113-182, 289-326.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122591. 10 interactions.
IntActi Q6UXH1. 28 interactions.
MINTi MINT-4827922.
STRINGi 9606.ENSP00000383938.

PTM databases

PhosphoSitei Q6UXH1.

Polymorphism databases

DMDMi 74738218.

Proteomic databases

MaxQBi Q6UXH1.
PaxDbi Q6UXH1.
PRIDEi Q6UXH1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000328268 ; ENSP00000332223 ; ENSG00000184164 . [Q6UXH1-1 ]
ENST00000403427 ; ENSP00000384111 ; ENSG00000184164 . [Q6UXH1-4 ]
ENST00000404488 ; ENSP00000383938 ; ENSG00000184164 . [Q6UXH1-5 ]
ENST00000407217 ; ENSP00000386034 ; ENSG00000184164 . [Q6UXH1-2 ]
GeneIDi 79174.
KEGGi hsa:79174.
UCSCi uc003biz.3. human. [Q6UXH1-3 ]
uc003bja.2. human. [Q6UXH1-1 ]
uc010haj.3. human. [Q6UXH1-6 ]
uc010hak.2. human. [Q6UXH1-4 ]
uc010hal.2. human. [Q6UXH1-5 ]
uc010ham.2. human. [Q6UXH1-2 ]

Organism-specific databases

CTDi 79174.
GeneCardsi GC22P050311.
H-InvDB HIX0018450.
HGNCi HGNC:28150. CRELD2.
HPAi CAB025604.
HPA000603.
MIMi 607171. gene.
neXtProti NX_Q6UXH1.
PharmGKBi PA142672079.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG315654.
GeneTreei ENSGT00680000100014.
HOVERGENi HBG081344.
InParanoidi Q6UXH1.
OMAi TCVGCTG.
PhylomeDBi Q6UXH1.
TreeFami TF316507.

Miscellaneous databases

ChiTaRSi CRELD2. human.
GeneWikii CRELD2.
GenomeRNAii 79174.
NextBioi 68145.
PROi Q6UXH1.
SOURCEi Search...

Gene expression databases

Bgeei Q6UXH1.
CleanExi HS_CRELD2.
ExpressionAtlasi Q6UXH1. baseline and differential.
Genevestigatori Q6UXH1.

Family and domain databases

InterProi IPR021852. DUF3456.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR002049. EGF_laminin.
IPR006212. Furin_repeat.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view ]
Pfami PF11938. DUF3456. 2 hits.
PF07645. EGF_CA. 1 hit.
[Graphical view ]
SMARTi SM00181. EGF. 1 hit.
SM00179. EGF_CA. 1 hit.
SM00261. FU. 2 hits.
[Graphical view ]
SUPFAMi SSF57184. SSF57184. 1 hit.
PROSITEi PS00010. ASX_HYDROXYL. 1 hit.
PS00022. EGF_1. 1 hit.
PS01186. EGF_2. 2 hits.
PS50026. EGF_3. 2 hits.
PS01187. EGF_CA. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The cysteine-rich with EGF-like domains 2 (CRELD2) protein interacts with the large cytoplasmic domain of human neuronal nicotinic acetylcholine receptor alpha4 and beta2 subunits."
    Ortiz J.A., Castillo M., Dominguez del Toro E., Mulet J., Gerber S., Valor L.M., Sala S., Sala F., Gutierrez L.M., Criado M.
    J. Neurochem. 95:1585-1596(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH CHRNA4.
    Tissue: Brain.
  2. "CRELD2: gene mapping, alternate splicing, and comparative genomic identification of the promoter region."
    Maslen C.L., Babcock D., Redig J.K., Kapeli K., Akkari Y.M., Olson S.B.
    Gene 382:111-120(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4; 5 AND 6), ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5 AND 6), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS ALA-295 AND GLY-325.
    Tissue: Lung carcinoma and Pancreatic carcinoma.
  7. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 25-39.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiCREL2_HUMAN
AccessioniPrimary (citable) accession number: Q6UXH1
Secondary accession number(s): A5GZA2
, A5GZA3, A5GZA4, A5GZA5, A5GZA6, Q4W0V0, Q86UC0, Q9BU47
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: July 5, 2004
Last modified: October 29, 2014
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3