Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CMRF35-like molecule 9

Gene

CD300LG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor which may mediate L-selectin-dependent lymphocyte rollings. Binds SELL in a calcium dependent manner. Binds lymphocyte (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Immunity

Enzyme and pathway databases

ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Names & Taxonomyi

Protein namesi
Recommended name:
CMRF35-like molecule 9
Short name:
CLM-9
Alternative name(s):
CD300 antigen-like family member G
Triggering receptor expressed on myeloid cells 4
Short name:
TREM-4
CD_antigen: CD300g
Gene namesi
Name:CD300LG
Synonyms:CLM9, TREM4
ORF Names:UNQ422/PRO846
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:30455. CD300LG.

Subcellular locationi

  • Apical cell membrane By similarity; Single-pass type I membrane protein By similarity
  • Basolateral cell membrane By similarity; Single-pass type I membrane protein By similarity
  • Endosomemultivesicular body membrane By similarity; Single-pass type I membrane protein By similarity

  • Note: Transcytoses across the cytoplasm.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini19 – 247229ExtracellularSequence analysisAdd
BLAST
Transmembranei248 – 26821HelicalSequence analysisAdd
BLAST
Topological domaini269 – 33264CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672154.

Polymorphism and mutation databases

BioMutaiCD300LG.
DMDMi296434455.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 18181 PublicationAdd
BLAST
Chaini19 – 332314CMRF35-like molecule 9PRO_0000306112Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi37 ↔ 107PROSITE-ProRule annotation
Glycosylationi96 – 961N-linked (GlcNAc...)Sequence analysis
Glycosylationi137 – 1371O-linked (GalNAc...)Sequence analysis
Glycosylationi143 – 1431O-linked (GalNAc...)Sequence analysis
Glycosylationi144 – 1441O-linked (GalNAc...)Sequence analysis
Glycosylationi155 – 1551O-linked (GalNAc...)Sequence analysis
Glycosylationi161 – 1611O-linked (GalNAc...)Sequence analysis
Glycosylationi170 – 1701O-linked (GalNAc...)Sequence analysis
Glycosylationi171 – 1711O-linked (GalNAc...)Sequence analysis
Glycosylationi177 – 1771O-linked (GalNAc...)Sequence analysis
Glycosylationi187 – 1871O-linked (GalNAc...)Sequence analysis
Glycosylationi195 – 1951O-linked (GalNAc...)Sequence analysis
Glycosylationi196 – 1961O-linked (GalNAc...)Sequence analysis
Glycosylationi199 – 1991O-linked (GalNAc...)Sequence analysis
Glycosylationi201 – 2011O-linked (GalNAc...)Sequence analysis
Glycosylationi202 – 2021O-linked (GalNAc...)Sequence analysis
Glycosylationi207 – 2071O-linked (GalNAc...)Sequence analysis
Glycosylationi208 – 2081O-linked (GalNAc...)Sequence analysis
Glycosylationi213 – 2131O-linked (GalNAc...)Sequence analysis
Glycosylationi214 – 2141O-linked (GalNAc...)Sequence analysis
Glycosylationi222 – 2221O-linked (GalNAc...)Sequence analysis
Glycosylationi223 – 2231O-linked (GalNAc...)Sequence analysis
Glycosylationi224 – 2241O-linked (GalNAc...)Sequence analysis
Glycosylationi228 – 2281O-linked (GalNAc...)Sequence analysis
Glycosylationi229 – 2291O-linked (GalNAc...)Sequence analysis
Glycosylationi237 – 2371O-linked (GalNAc...)Sequence analysis

Post-translational modificationi

O-glycosylated with sialylated oligosaccharides.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ6UXG3.
PeptideAtlasiQ6UXG3.
PRIDEiQ6UXG3.

PTM databases

iPTMnetiQ6UXG3.
PhosphoSiteiQ6UXG3.

Expressioni

Tissue specificityi

Highly expressed in heart, skeletal muscle and placenta.1 Publication

Gene expression databases

BgeeiENSG00000161649.
CleanExiHS_CD300LG.
ExpressionAtlasiQ6UXG3. baseline and differential.
GenevisibleiQ6UXG3. HS.

Organism-specific databases

HPAiHPA004131.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
KRTAP10-9P604113EBI-10254587,EBI-10172052

Protein-protein interaction databases

BioGridi127023. 2 interactions.
IntActiQ6UXG3. 1 interaction.
STRINGi9606.ENSP00000321005.

Structurei

3D structure databases

ProteinModelPortaliQ6UXG3.
SMRiQ6UXG3. Positions 25-110.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini19 – 121103Ig-like V-typeAdd
BLAST

Domaini

Ig-like V-type domain mediates binding to lymphocyte.By similarity

Sequence similaritiesi

Belongs to the CD300 family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J03P. Eukaryota.
ENOG41114KV. LUCA.
GeneTreeiENSGT00470000042273.
HOGENOMiHOG000168404.
HOVERGENiHBG107721.
InParanoidiQ6UXG3.
KOiK16663.
OMAiLFVFPGS.
OrthoDBiEOG091G0MYS.
PhylomeDBiQ6UXG3.
TreeFamiTF334441.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6UXG3-1) [UniParc]FASTAAdd to basket
Also known as: CD300LG-gamma

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLLVLLWGC LLLPGYEALE GPEEISGFEG DTVSLQCTYR EELRDHRKYW
60 70 80 90 100
CRKGGILFSR CSGTIYAEEE GQETMKGRVS IRDSRQELSL IVTLWNLTLQ
110 120 130 140 150
DAGEYWCGVE KRGPDESLLI SLFVFPGPCC PPSPSPTFQP LATTRLQPKA
160 170 180 190 200
KAQQTQPPGL TSPGLYPAAT TAKQGKTGAE APPLPGTSQY GHERTSQYTG
210 220 230 240 250
TSPHPATSPP AGSSRPPMQL DSTSAEDTSP ALSSGSSKPR VSIPMVRILA
260 270 280 290 300
PVLVLLSLLS AAGLIAFCSH LLLWRKEAQQ ATETQRNEKF CLSRLTAEEK
310 320 330
EAPSQAPEGD VISMPPLHTS EEELGFSKFV SA
Length:332
Mass (Da):36,060
Last modified:May 18, 2010 - v2
Checksum:i2347FF0FA55515FB
GO
Isoform 2 (identifier: Q6UXG3-2) [UniParc]FASTAAdd to basket
Also known as: TREM4-alpha, CD300LG-alpha 1

The sequence of this isoform differs from the canonical sequence as follows:
     127-211: Missing.
     296-332: TAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA → NHRTSELDPDEAFEISSLTFLSV

Show »
Length:233
Mass (Da):26,091
Checksum:i8D227B31A9739898
GO
Isoform 3 (identifier: Q6UXG3-3) [UniParc]FASTAAdd to basket
Also known as: TREM4-beta, CD300LG-alpha 2

The sequence of this isoform differs from the canonical sequence as follows:
     127-211: Missing.
     296-332: TAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA → NSLMFSLSLPWL

Show »
Length:222
Mass (Da):24,891
Checksum:i5E3DC88C1EDF86D4
GO
Isoform 4 (identifier: Q6UXG3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-332: TAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA → NSLMFSLSLPWL

Note: No experimental confirmation available.
Show »
Length:307
Mass (Da):33,521
Checksum:i3E0ED9B3BC4E569D
GO
Isoform 5 (identifier: Q6UXG3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-161: GPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLT → A
     296-332: TAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA → NSLMFSLSLPWL

Note: No experimental confirmation available.
Show »
Length:273
Mass (Da):29,965
Checksum:i8EBC7C234BADF339
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti10 – 101C → W in AAN86134 (Ref. 1) Curated
Sequence conflicti10 – 101C → W in AAN86135 (Ref. 1) Curated
Sequence conflicti45 – 451D → G in AAN86134 (Ref. 1) Curated
Sequence conflicti45 – 451D → G in AAN86135 (Ref. 1) Curated
Sequence conflicti64 – 641T → H in AAN86134 (Ref. 1) Curated
Sequence conflicti64 – 641T → H in AAN86135 (Ref. 1) Curated
Sequence conflicti79 – 791V → L in AAN86134 (Ref. 1) Curated
Sequence conflicti79 – 791V → L in AAN86135 (Ref. 1) Curated
Sequence conflicti113 – 1131G → A in AAN86134 (Ref. 1) Curated
Sequence conflicti113 – 1131G → A in AAN86135 (Ref. 1) Curated
Sequence conflicti291 – 2911C → W in AAQ88730 (PubMed:12975309).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti221 – 2211D → N.1 Publication
Corresponds to variant rs17852267 [ dbSNP | Ensembl ].
VAR_035261
Natural varianti228 – 2281T → A.1 Publication
Corresponds to variant rs12453522 [ dbSNP | Ensembl ].
VAR_035262

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei127 – 21185Missing in isoform 2 and isoform 3. 1 PublicationVSP_028410Add
BLAST
Alternative sequencei127 – 16135GPCCP…PPGLT → A in isoform 5. 1 PublicationVSP_045362Add
BLAST
Alternative sequencei296 – 33237TAEEK…KFVSA → NHRTSELDPDEAFEISSLTF LSV in isoform 2. 1 PublicationVSP_028411Add
BLAST
Alternative sequencei296 – 33237TAEEK…KFVSA → NSLMFSLSLPWL in isoform 3, isoform 4 and isoform 5. 2 PublicationsVSP_028412Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF427619 mRNA. Translation: AAN86134.1.
AF427620 mRNA. Translation: AAN86135.1.
AY358364 mRNA. Translation: AAQ88730.1.
AK298112 mRNA. Translation: BAG60397.1.
AK309938 mRNA. No translation available.
AC007993 Genomic DNA. No translation available.
AC015937 Genomic DNA. No translation available.
BC025395 mRNA. Translation: AAH25395.1.
CCDSiCCDS11470.1. [Q6UXG3-1]
CCDS54131.1. [Q6UXG3-4]
CCDS54132.1. [Q6UXG3-5]
CCDS54133.1. [Q6UXG3-2]
RefSeqiNP_001161794.1. NM_001168322.1. [Q6UXG3-4]
NP_001161795.1. NM_001168323.1. [Q6UXG3-5]
NP_001161796.1. NM_001168324.1. [Q6UXG3-2]
NP_660316.2. NM_145273.3. [Q6UXG3-1]
UniGeneiHs.147313.

Genome annotation databases

EnsembliENST00000293396; ENSP00000293396; ENSG00000161649. [Q6UXG3-2]
ENST00000317310; ENSP00000321005; ENSG00000161649. [Q6UXG3-1]
ENST00000377203; ENSP00000366408; ENSG00000161649. [Q6UXG3-5]
ENST00000539718; ENSP00000442368; ENSG00000161649. [Q6UXG3-4]
ENST00000586233; ENSP00000468800; ENSG00000161649. [Q6UXG3-3]
GeneIDi146894.
KEGGihsa:146894.
UCSCiuc002iel.3. human. [Q6UXG3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF427619 mRNA. Translation: AAN86134.1.
AF427620 mRNA. Translation: AAN86135.1.
AY358364 mRNA. Translation: AAQ88730.1.
AK298112 mRNA. Translation: BAG60397.1.
AK309938 mRNA. No translation available.
AC007993 Genomic DNA. No translation available.
AC015937 Genomic DNA. No translation available.
BC025395 mRNA. Translation: AAH25395.1.
CCDSiCCDS11470.1. [Q6UXG3-1]
CCDS54131.1. [Q6UXG3-4]
CCDS54132.1. [Q6UXG3-5]
CCDS54133.1. [Q6UXG3-2]
RefSeqiNP_001161794.1. NM_001168322.1. [Q6UXG3-4]
NP_001161795.1. NM_001168323.1. [Q6UXG3-5]
NP_001161796.1. NM_001168324.1. [Q6UXG3-2]
NP_660316.2. NM_145273.3. [Q6UXG3-1]
UniGeneiHs.147313.

3D structure databases

ProteinModelPortaliQ6UXG3.
SMRiQ6UXG3. Positions 25-110.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127023. 2 interactions.
IntActiQ6UXG3. 1 interaction.
STRINGi9606.ENSP00000321005.

PTM databases

iPTMnetiQ6UXG3.
PhosphoSiteiQ6UXG3.

Polymorphism and mutation databases

BioMutaiCD300LG.
DMDMi296434455.

Proteomic databases

PaxDbiQ6UXG3.
PeptideAtlasiQ6UXG3.
PRIDEiQ6UXG3.

Protocols and materials databases

DNASUi146894.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000293396; ENSP00000293396; ENSG00000161649. [Q6UXG3-2]
ENST00000317310; ENSP00000321005; ENSG00000161649. [Q6UXG3-1]
ENST00000377203; ENSP00000366408; ENSG00000161649. [Q6UXG3-5]
ENST00000539718; ENSP00000442368; ENSG00000161649. [Q6UXG3-4]
ENST00000586233; ENSP00000468800; ENSG00000161649. [Q6UXG3-3]
GeneIDi146894.
KEGGihsa:146894.
UCSCiuc002iel.3. human. [Q6UXG3-1]

Organism-specific databases

CTDi146894.
GeneCardsiCD300LG.
H-InvDBHIX0013869.
HGNCiHGNC:30455. CD300LG.
HPAiHPA004131.
MIMi610520. gene.
neXtProtiNX_Q6UXG3.
PharmGKBiPA142672154.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J03P. Eukaryota.
ENOG41114KV. LUCA.
GeneTreeiENSGT00470000042273.
HOGENOMiHOG000168404.
HOVERGENiHBG107721.
InParanoidiQ6UXG3.
KOiK16663.
OMAiLFVFPGS.
OrthoDBiEOG091G0MYS.
PhylomeDBiQ6UXG3.
TreeFamiTF334441.

Enzyme and pathway databases

ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Miscellaneous databases

GenomeRNAii146894.
PROiQ6UXG3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000161649.
CleanExiHS_CD300LG.
ExpressionAtlasiQ6UXG3. baseline and differential.
GenevisibleiQ6UXG3. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCLM9_HUMAN
AccessioniPrimary (citable) accession number: Q6UXG3
Secondary accession number(s): B4DNY5
, F5H7P9, F8W9M3, Q8IX38, Q8IX39, Q8TA95
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: May 18, 2010
Last modified: September 7, 2016
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.