Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Layilin

Gene

LAYN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Receptor for hyaluronate.1 Publication

GO - Molecular functioni

  • carbohydrate binding Source: UniProtKB-KW
  • hyaluronic acid binding Source: HGNC
Complete GO annotation...

Keywords - Ligandi

Lectin

Enzyme and pathway databases

BioCyciZFISH:G66-33575-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Layilin
Gene namesi
Name:LAYN
ORF Names:UNQ208/PRO234
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:29471. LAYN.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini22 – 235ExtracellularSequence analysisAdd BLAST214
Transmembranei236 – 256HelicalSequence analysisAdd BLAST21
Topological domaini257 – 382CytoplasmicSequence analysisAdd BLAST126

GO - Cellular componenti

  • cell surface Source: HGNC
  • focal adhesion Source: UniProtKB
  • integral component of membrane Source: UniProtKB-KW
  • ruffle Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi143903.
OpenTargetsiENSG00000204381.
PharmGKBiPA142671570.

Chemistry databases

DrugBankiDB08818. Hyaluronic acid.

Polymorphism and mutation databases

BioMutaiLAYN.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000026250822 – 382LayilinAdd BLAST361

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi71 ↔ 184PROSITE-ProRule annotation
Glycosylationi117N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi150 ↔ 176PROSITE-ProRule annotation
Modified residuei286PhosphoserineBy similarity1
Modified residuei299PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ6UX15.
MaxQBiQ6UX15.
PaxDbiQ6UX15.
PeptideAtlasiQ6UX15.
PRIDEiQ6UX15.

PTM databases

iPTMnetiQ6UX15.
PhosphoSitePlusiQ6UX15.
SwissPalmiQ6UX15.

Expressioni

Gene expression databases

BgeeiENSG00000204381.
CleanExiHS_LAYN.
ExpressionAtlasiQ6UX15. baseline and differential.
GenevisibleiQ6UX15. HS.

Organism-specific databases

HPAiHPA040087.

Interactioni

Subunit structurei

Interacts with NF2, RDX and TLN1.By similarity

Protein-protein interaction databases

BioGridi126823. 1 interactor.
IntActiQ6UX15. 1 interactor.
STRINGi9606.ENSP00000364764.

Structurei

3D structure databases

ProteinModelPortaliQ6UX15.
SMRiQ6UX15.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 185C-type lectinPROSITE-ProRule annotationAdd BLAST141
Repeati340 – 3441-15
Repeati350 – 3541-25
Repeati356 – 3592-14
Repeati371 – 3751-35
Repeati377 – 3802-24

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni330 – 374Interaction with NF2By similarityAdd BLAST45
Regioni337 – 382Interaction with TLN1By similarityAdd BLAST46
Regioni340 – 3753 X 5 AA repeats of E-S-G-X-VAdd BLAST36
Regioni356 – 3802 X 4 AA repeats of N-X-I-YAdd BLAST25

Domaini

The C-terminal domain interacts with the N-terminal domain of RDX.By similarity

Sequence similaritiesi

Contains 1 C-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IS3Y. Eukaryota.
ENOG410XR2Y. LUCA.
GeneTreeiENSGT00390000001844.
HOGENOMiHOG000294068.
HOVERGENiHBG050945.
InParanoidiQ6UX15.
KOiK10077.
OMAiTACQDLY.
OrthoDBiEOG091G0FDX.
PhylomeDBiQ6UX15.
TreeFamiTF330715.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR016187. CTDL_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6UX15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRPGTALQAV LLAVLLVGLR AATGRLLSAS DLDLRGGQPV CRGGTQRPCY
60 70 80 90 100
KVIYFHDTSR RLNFEEAKEA CRRDGGQLVS IESEDEQKLI EKFIENLLPS
110 120 130 140 150
DGDFWIGLRR REEKQSNSTA CQDLYAWTDG SISQFRNWYV DEPSCGSEVC
160 170 180 190 200
VVMYHQPSAP AGIGGPYMFQ WNDDRCNMKN NFICKYSDEK PAVPSREAEG
210 220 230 240 250
EETELTTPVL PEETQEEDAK KTFKESREAA LNLAYILIPS IPLLLLLVVT
260 270 280 290 300
TVVCWVWICR KRKREQPDPS TKKQHTIWPS PHQGNSPDLE VYNVIRKQSE
310 320 330 340 350
ADLAETRPDL KNISFRVCSG EATPDDMSCD YDNMAVNPSE SGFVTLVSVE
360 370 380
SGFVTNDIYE FSPDQMGRSK ESGWVENEIY GY
Length:382
Mass (Da):43,108
Last modified:July 5, 2004 - v1
Checksum:i5843084E56E11325
GO
Isoform 2 (identifier: Q6UX15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-36: Missing.

Show »
Length:374
Mass (Da):42,281
Checksum:i8AE64E6BC9E56DCD
GO
Isoform 3 (identifier: Q6UX15-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MRPGTALQAVLLAVLLVGLRAATGRLLSASDLDLR → MVTSGLGSGGVRRNKAIAQPARTFMLGLMAAYHNL
     36-188: Missing.

Note: No experimental confirmation available.
Show »
Length:229
Mass (Da):25,571
Checksum:i0EE863791994B444
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti219A → T in BAB70978 (PubMed:14702039).Curated1
Sequence conflicti344V → M in AAH25407 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02949666E → K.Corresponds to variant rs11827718dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0546601 – 35MRPGT…DLDLR → MVTSGLGSGGVRRNKAIAQP ARTFMLGLMAAYHNL in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_02178129 – 36Missing in isoform 2. 2 Publications8
Alternative sequenceiVSP_05466136 – 188Missing in isoform 3. 1 PublicationAdd BLAST153

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358554 mRNA. Translation: AAQ88918.1.
AK055539 mRNA. Translation: BAB70946.1.
AK055654 mRNA. Translation: BAB70978.1.
AK296231 mRNA. Translation: BAG58952.1.
AP002008 Genomic DNA. No translation available.
CH471065 Genomic DNA. Translation: EAW67145.1.
BC025407 mRNA. Translation: AAH25407.1.
CCDSiCCDS31676.1. [Q6UX15-2]
CCDS58178.1. [Q6UX15-1]
CCDS58179.1. [Q6UX15-3]
RefSeqiNP_001245319.1. NM_001258390.1. [Q6UX15-1]
NP_001245320.1. NM_001258391.1. [Q6UX15-3]
NP_001305728.1. NM_001318799.1.
NP_849156.1. NM_178834.4. [Q6UX15-2]
XP_006718833.1. XM_006718770.3. [Q6UX15-3]
UniGeneiHs.503831.

Genome annotation databases

EnsembliENST00000375614; ENSP00000364764; ENSG00000204381. [Q6UX15-2]
ENST00000375615; ENSP00000364765; ENSG00000204381. [Q6UX15-1]
ENST00000436913; ENSP00000392942; ENSG00000204381. [Q6UX15-3]
GeneIDi143903.
KEGGihsa:143903.
UCSCiuc001plp.3. human. [Q6UX15-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358554 mRNA. Translation: AAQ88918.1.
AK055539 mRNA. Translation: BAB70946.1.
AK055654 mRNA. Translation: BAB70978.1.
AK296231 mRNA. Translation: BAG58952.1.
AP002008 Genomic DNA. No translation available.
CH471065 Genomic DNA. Translation: EAW67145.1.
BC025407 mRNA. Translation: AAH25407.1.
CCDSiCCDS31676.1. [Q6UX15-2]
CCDS58178.1. [Q6UX15-1]
CCDS58179.1. [Q6UX15-3]
RefSeqiNP_001245319.1. NM_001258390.1. [Q6UX15-1]
NP_001245320.1. NM_001258391.1. [Q6UX15-3]
NP_001305728.1. NM_001318799.1.
NP_849156.1. NM_178834.4. [Q6UX15-2]
XP_006718833.1. XM_006718770.3. [Q6UX15-3]
UniGeneiHs.503831.

3D structure databases

ProteinModelPortaliQ6UX15.
SMRiQ6UX15.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126823. 1 interactor.
IntActiQ6UX15. 1 interactor.
STRINGi9606.ENSP00000364764.

Chemistry databases

DrugBankiDB08818. Hyaluronic acid.

PTM databases

iPTMnetiQ6UX15.
PhosphoSitePlusiQ6UX15.
SwissPalmiQ6UX15.

Polymorphism and mutation databases

BioMutaiLAYN.

Proteomic databases

EPDiQ6UX15.
MaxQBiQ6UX15.
PaxDbiQ6UX15.
PeptideAtlasiQ6UX15.
PRIDEiQ6UX15.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375614; ENSP00000364764; ENSG00000204381. [Q6UX15-2]
ENST00000375615; ENSP00000364765; ENSG00000204381. [Q6UX15-1]
ENST00000436913; ENSP00000392942; ENSG00000204381. [Q6UX15-3]
GeneIDi143903.
KEGGihsa:143903.
UCSCiuc001plp.3. human. [Q6UX15-1]

Organism-specific databases

CTDi143903.
DisGeNETi143903.
GeneCardsiLAYN.
H-InvDBHIX0010105.
HGNCiHGNC:29471. LAYN.
HPAiHPA040087.
neXtProtiNX_Q6UX15.
OpenTargetsiENSG00000204381.
PharmGKBiPA142671570.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IS3Y. Eukaryota.
ENOG410XR2Y. LUCA.
GeneTreeiENSGT00390000001844.
HOGENOMiHOG000294068.
HOVERGENiHBG050945.
InParanoidiQ6UX15.
KOiK10077.
OMAiTACQDLY.
OrthoDBiEOG091G0FDX.
PhylomeDBiQ6UX15.
TreeFamiTF330715.

Enzyme and pathway databases

BioCyciZFISH:G66-33575-MONOMER.

Miscellaneous databases

GenomeRNAii143903.
PROiQ6UX15.

Gene expression databases

BgeeiENSG00000204381.
CleanExiHS_LAYN.
ExpressionAtlasiQ6UX15. baseline and differential.
GenevisibleiQ6UX15. HS.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR016187. CTDL_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLAYN_HUMAN
AccessioniPrimary (citable) accession number: Q6UX15
Secondary accession number(s): A6NJB0
, B4DJU0, Q8TAY8, Q96NC5, Q96NF3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: July 5, 2004
Last modified: November 30, 2016
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.