Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6UX01

- LMBRL_HUMAN

UniProt

Q6UX01 - LMBRL_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein LMBR1L

Gene

LMBR1L

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Probable LCN1 receptor. May mediate LCN1 endocytosis.2 Publications

GO - Biological processi

  1. endocytosis Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Endocytosis

Names & Taxonomyi

Protein namesi
Recommended name:
Protein LMBR1L
Alternative name(s):
Limb region 1 protein homolog-like
Lipocalin-1-interacting membrane receptor
Short name:
Lipocalin-interacting membrane receptor
Gene namesi
Name:LMBR1L
Synonyms:KIAA1174, LIMR
ORF Names:UNQ458/PRO783
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:18268. LMBR1L.

Subcellular locationi

Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671545.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 489489Protein LMBR1LPRO_0000053910Add
BLAST

Proteomic databases

PaxDbiQ6UX01.
PRIDEiQ6UX01.

Expressioni

Tissue specificityi

Expressed in testis, pituitary gland, adrenal gland, trachea, placenta, thymus, cerebellum, stomach, mammary gland, spinal cord. A weaker expression is detected in colon, pancreas, and prostate.1 Publication

Developmental stagei

Expressed in fetal kidney and lung.1 Publication

Gene expression databases

BgeeiQ6UX01.
CleanExiHS_LMBR1L.
ExpressionAtlasiQ6UX01. baseline and differential.
GenevestigatoriQ6UX01.

Organism-specific databases

HPAiHPA057569.

Interactioni

Protein-protein interaction databases

BioGridi120838. 1 interaction.
IntActiQ6UX01. 1 interaction.
STRINGi9606.ENSP00000267102.

Structurei

3D structure databases

ProteinModelPortaliQ6UX01.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2121ExtracellularSequence AnalysisAdd
BLAST
Topological domaini43 – 6624CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini88 – 11427ExtracellularSequence AnalysisAdd
BLAST
Topological domaini136 – 15419CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini176 – 19621ExtracellularSequence AnalysisAdd
BLAST
Topological domaini218 – 30588CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini327 – 35024ExtracellularSequence AnalysisAdd
BLAST
Topological domaini372 – 38817CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini410 – 43122ExtracellularSequence AnalysisAdd
BLAST
Topological domaini453 – 48937CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei22 – 4221HelicalSequence AnalysisAdd
BLAST
Transmembranei67 – 8721HelicalSequence AnalysisAdd
BLAST
Transmembranei115 – 13521HelicalSequence AnalysisAdd
BLAST
Transmembranei155 – 17521HelicalSequence AnalysisAdd
BLAST
Transmembranei197 – 21721HelicalSequence AnalysisAdd
BLAST
Transmembranei306 – 32621HelicalSequence AnalysisAdd
BLAST
Transmembranei351 – 37121HelicalSequence AnalysisAdd
BLAST
Transmembranei389 – 40921HelicalSequence AnalysisAdd
BLAST
Transmembranei432 – 45221HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 7676LCN1-bindingAdd
BLAST

Sequence similaritiesi

Belongs to the LIMR family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG246746.
GeneTreeiENSGT00390000007809.
HOVERGENiHBG072983.
InParanoidiQ6UX01.
OMAiRVYETFT.
OrthoDBiEOG790G68.
PhylomeDBiQ6UX01.
TreeFamiTF313485.

Family and domain databases

InterProiIPR008075. Lipcalin_1_rcpt.
IPR006876. LMBR1-like_membr_prot.
[Graphical view]
PfamiPF04791. LMBR1. 1 hit.
[Graphical view]
PRINTSiPR01692. LIPOCALINIMR.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6UX01-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAPDYEVLS VREQLFHERI RECIISTLLF ATLYILCHIF LTRFKKPAEF
60 70 80 90 100
TTVDDEDATV NKIALELCTF TLAIALGAVL LLPFSIISNE VLLSLPRNYY
110 120 130 140 150
IQWLNGSLIH GLWNLVFLFS NLSLIFLMPF AYFFTESEGF AGSRKGVLGR
160 170 180 190 200
VYETVVMLML LTLLVLGMVW VASAIVDKNK ANRESLYDFW EYYLPYLYSC
210 220 230 240 250
ISFLGVLLLL VCTPLGLARM FSVTGKLLVK PRLLEDLEEQ LYCSAFEEAA
260 270 280 290 300
LTRRICNPTS CWLPLDMELL HRQVLALQTQ RVLLEKRRKA SAWQRNLGYP
310 320 330 340 350
LAMLCLLVLT GLSVLIVAIH ILELLIDEAA MPRGMQGTSL GQVSFSKLGS
360 370 380 390 400
FGAVIQVVLI FYLMVSSVVG FYSSPLFRSL RPRWHDTAMT QIIGNCVCLL
410 420 430 440 450
VLSSALPVFS RTLGLTRFDL LGDFGRFNWL GNFYIVFLYN AAFAGLTTLC
460 470 480
LVKTFTAAVR AELIRAFGLD RLPLPVSGFP QASRKTQHQ
Length:489
Mass (Da):55,209
Last modified:January 10, 2006 - v2
Checksum:i80D169C977F182E2
GO
Isoform 2 (identifier: Q6UX01-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-54: Missing.

Show »
Length:487
Mass (Da):54,995
Checksum:iC98C4510D10E9042
GO
Isoform 3 (identifier: Q6UX01-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-355: Missing.

Show »
Length:469
Mass (Da):53,244
Checksum:i49FB3525632D3335
GO
Isoform 4 (identifier: Q6UX01-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MEAPDYEVLS...RFKKPAEFTT → MVNVKALCEP...PETSLMTGEP

Show »
Length:484
Mass (Da):53,890
Checksum:i285F0F2180A084E5
GO
Isoform 5 (identifier: Q6UX01-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     363-393: LMVSSVVGFYSSPLFRSLRPRWHDTAMTQII → PSGNPSLPLFSKPVSWDSRPSTSWTLSPLGL
     394-489: Missing.

Note: No experimental confirmation available.

Show »
Length:393
Mass (Da):44,358
Checksum:i3F3D73D213863E3A
GO

Sequence cautioni

The sequence BAA86488.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti11 – 111V → A in BAA91811. (PubMed:14702039)Curated
Sequence conflicti120 – 1201S → P in AAQ88935. (PubMed:12975309)Curated
Sequence conflicti157 – 1571M → T in BAA91646. (PubMed:14702039)Curated
Sequence conflicti211 – 2111V → L in AAH08337. (PubMed:15489334)Curated
Sequence conflicti334 – 3341G → V in BAA91646. (PubMed:14702039)Curated
Sequence conflicti361 – 3611F → L in BAA86488. (PubMed:10574461)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5252MEAPD…AEFTT → MVNVKALCEPEVSNCWMNVI TGTGSVSSPLLVLPQPGPET SLMTGEP in isoform 4. 1 PublicationVSP_016892Add
BLAST
Alternative sequencei53 – 542Missing in isoform 2. 1 PublicationVSP_016893
Alternative sequencei336 – 35520Missing in isoform 3. 2 PublicationsVSP_016894Add
BLAST
Alternative sequencei363 – 39331LMVSS…MTQII → PSGNPSLPLFSKPVSWDSRP STSWTLSPLGL in isoform 5. 1 PublicationVSP_016895Add
BLAST
Alternative sequencei394 – 48996Missing in isoform 5. 1 PublicationVSP_016896Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF260728 mRNA. Translation: AAK60600.1.
AF351620 Genomic DNA. Translation: AAK63067.1.
AB033000 mRNA. Translation: BAA86488.1. Different initiation.
AY358572 mRNA. Translation: AAQ88935.1.
AK001356 mRNA. Translation: BAA91646.1.
AK001651 mRNA. Translation: BAA91811.1.
BC008337 mRNA. Translation: AAH08337.1.
BC015015 mRNA. Translation: AAH15015.1.
BC031550 mRNA. Translation: AAH31550.1.
AL137599 mRNA. Translation: CAB70835.1.
CCDSiCCDS73466.1. [Q6UX01-3]
CCDS8780.2. [Q6UX01-1]
PIRiT46306.
RefSeqiNP_060583.2. NM_018113.3. [Q6UX01-1]
UniGeneiHs.272838.

Genome annotation databases

EnsembliENST00000267102; ENSP00000267102; ENSG00000139636. [Q6UX01-1]
ENST00000547382; ENSP00000447329; ENSG00000139636. [Q6UX01-3]
GeneIDi55716.
KEGGihsa:55716.
UCSCiuc001rtg.4. human. [Q6UX01-4]
uc001rth.4. human. [Q6UX01-1]
uc001rti.4. human. [Q6UX01-3]
uc009zld.1. human. [Q6UX01-5]

Polymorphism databases

DMDMi85681040.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF260728 mRNA. Translation: AAK60600.1 .
AF351620 Genomic DNA. Translation: AAK63067.1 .
AB033000 mRNA. Translation: BAA86488.1 . Different initiation.
AY358572 mRNA. Translation: AAQ88935.1 .
AK001356 mRNA. Translation: BAA91646.1 .
AK001651 mRNA. Translation: BAA91811.1 .
BC008337 mRNA. Translation: AAH08337.1 .
BC015015 mRNA. Translation: AAH15015.1 .
BC031550 mRNA. Translation: AAH31550.1 .
AL137599 mRNA. Translation: CAB70835.1 .
CCDSi CCDS73466.1. [Q6UX01-3 ]
CCDS8780.2. [Q6UX01-1 ]
PIRi T46306.
RefSeqi NP_060583.2. NM_018113.3. [Q6UX01-1 ]
UniGenei Hs.272838.

3D structure databases

ProteinModelPortali Q6UX01.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120838. 1 interaction.
IntActi Q6UX01. 1 interaction.
STRINGi 9606.ENSP00000267102.

Polymorphism databases

DMDMi 85681040.

Proteomic databases

PaxDbi Q6UX01.
PRIDEi Q6UX01.

Protocols and materials databases

DNASUi 55716.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000267102 ; ENSP00000267102 ; ENSG00000139636 . [Q6UX01-1 ]
ENST00000547382 ; ENSP00000447329 ; ENSG00000139636 . [Q6UX01-3 ]
GeneIDi 55716.
KEGGi hsa:55716.
UCSCi uc001rtg.4. human. [Q6UX01-4 ]
uc001rth.4. human. [Q6UX01-1 ]
uc001rti.4. human. [Q6UX01-3 ]
uc009zld.1. human. [Q6UX01-5 ]

Organism-specific databases

CTDi 55716.
GeneCardsi GC12M049490.
H-InvDB HIX0010593.
HGNCi HGNC:18268. LMBR1L.
HPAi HPA057569.
MIMi 610007. gene.
neXtProti NX_Q6UX01.
PharmGKBi PA142671545.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG246746.
GeneTreei ENSGT00390000007809.
HOVERGENi HBG072983.
InParanoidi Q6UX01.
OMAi RVYETFT.
OrthoDBi EOG790G68.
PhylomeDBi Q6UX01.
TreeFami TF313485.

Miscellaneous databases

GeneWikii LMBR1L.
GenomeRNAii 55716.
NextBioi 60603.
PROi Q6UX01.
SOURCEi Search...

Gene expression databases

Bgeei Q6UX01.
CleanExi HS_LMBR1L.
ExpressionAtlasi Q6UX01. baseline and differential.
Genevestigatori Q6UX01.

Family and domain databases

InterProi IPR008075. Lipcalin_1_rcpt.
IPR006876. LMBR1-like_membr_prot.
[Graphical view ]
Pfami PF04791. LMBR1. 1 hit.
[Graphical view ]
PRINTSi PR01692. LIPOCALINIMR.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of a novel lipocalin-1 interacting human cell membrane receptor using phage display."
    Wojnar P., Lechner M., Merschak P., Redl B.
    J. Biol. Chem. 276:20206-20212(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 2), FUNCTION, TOPOLOGY, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE.
    Tissue: Pituitary.
  2. "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
    Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
    DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Teratocarcinoma.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Brain, Kidney and Uterus.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 89-489 (ISOFORMS 1/2/4).
    Tissue: Testis.
  7. "Antisense down-regulation of lipocalin-interacting membrane receptor expression inhibits cellular internalization of lipocalin-1 in human NT2 cells."
    Wojnar P., Lechner M., Redl B.
    J. Biol. Chem. 278:16209-16215(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiLMBRL_HUMAN
AccessioniPrimary (citable) accession number: Q6UX01
Secondary accession number(s): Q969J4
, Q96BY8, Q96HN8, Q9NT09, Q9NVE1, Q9NVU9, Q9ULP6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: October 29, 2014
This is version 86 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3