Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein LMBR1L

Gene

LMBR1L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable LCN1 receptor. May mediate LCN1 endocytosis.2 Publications

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Endocytosis

Names & Taxonomyi

Protein namesi
Recommended name:
Protein LMBR1L
Alternative name(s):
Limb region 1 protein homolog-like
Lipocalin-1-interacting membrane receptor
Short name:
Lipocalin-interacting membrane receptor
Gene namesi
Name:LMBR1L
Synonyms:KIAA1174, LIMR
ORF Names:UNQ458/PRO783
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:18268. LMBR1L.

Subcellular locationi

  • Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 21ExtracellularSequence analysisAdd BLAST21
Transmembranei22 – 42HelicalSequence analysisAdd BLAST21
Topological domaini43 – 66CytoplasmicSequence analysisAdd BLAST24
Transmembranei67 – 87HelicalSequence analysisAdd BLAST21
Topological domaini88 – 114ExtracellularSequence analysisAdd BLAST27
Transmembranei115 – 135HelicalSequence analysisAdd BLAST21
Topological domaini136 – 154CytoplasmicSequence analysisAdd BLAST19
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Topological domaini176 – 196ExtracellularSequence analysisAdd BLAST21
Transmembranei197 – 217HelicalSequence analysisAdd BLAST21
Topological domaini218 – 305CytoplasmicSequence analysisAdd BLAST88
Transmembranei306 – 326HelicalSequence analysisAdd BLAST21
Topological domaini327 – 350ExtracellularSequence analysisAdd BLAST24
Transmembranei351 – 371HelicalSequence analysisAdd BLAST21
Topological domaini372 – 388CytoplasmicSequence analysisAdd BLAST17
Transmembranei389 – 409HelicalSequence analysisAdd BLAST21
Topological domaini410 – 431ExtracellularSequence analysisAdd BLAST22
Transmembranei432 – 452HelicalSequence analysisAdd BLAST21
Topological domaini453 – 489CytoplasmicSequence analysisAdd BLAST37

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000139636.
PharmGKBiPA142671545.

Polymorphism and mutation databases

BioMutaiLMBR1L.
DMDMi85681040.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000539101 – 489Protein LMBR1LAdd BLAST489

Proteomic databases

MaxQBiQ6UX01.
PaxDbiQ6UX01.
PeptideAtlasiQ6UX01.
PRIDEiQ6UX01.

PTM databases

iPTMnetiQ6UX01.
PhosphoSitePlusiQ6UX01.

Expressioni

Tissue specificityi

Expressed in testis, pituitary gland, adrenal gland, trachea, placenta, thymus, cerebellum, stomach, mammary gland, spinal cord. A weaker expression is detected in colon, pancreas, and prostate.1 Publication

Developmental stagei

Expressed in fetal kidney and lung.1 Publication

Gene expression databases

BgeeiENSG00000139636.
CleanExiHS_LMBR1L.
ExpressionAtlasiQ6UX01. baseline and differential.
GenevisibleiQ6UX01. HS.

Organism-specific databases

HPAiHPA057569.

Interactioni

Protein-protein interaction databases

BioGridi120838. 5 interactors.
IntActiQ6UX01. 4 interactors.
STRINGi9606.ENSP00000267102.

Structurei

3D structure databases

ProteinModelPortaliQ6UX01.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 76LCN1-bindingAdd BLAST76

Sequence similaritiesi

Belongs to the LIMR family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3722. Eukaryota.
ENOG410YKEX. LUCA.
GeneTreeiENSGT00390000007809.
HOVERGENiHBG072983.
InParanoidiQ6UX01.
OMAiYMEEASV.
OrthoDBiEOG091G05XM.
PhylomeDBiQ6UX01.
TreeFamiTF313485.

Family and domain databases

InterProiIPR008075. LIMR.
IPR006876. LMBR1-like_membr_prot.
[Graphical view]
PANTHERiPTHR12625. PTHR12625. 1 hit.
PfamiPF04791. LMBR1. 2 hits.
[Graphical view]
PRINTSiPR01692. LIPOCALINIMR.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6UX01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAPDYEVLS VREQLFHERI RECIISTLLF ATLYILCHIF LTRFKKPAEF
60 70 80 90 100
TTVDDEDATV NKIALELCTF TLAIALGAVL LLPFSIISNE VLLSLPRNYY
110 120 130 140 150
IQWLNGSLIH GLWNLVFLFS NLSLIFLMPF AYFFTESEGF AGSRKGVLGR
160 170 180 190 200
VYETVVMLML LTLLVLGMVW VASAIVDKNK ANRESLYDFW EYYLPYLYSC
210 220 230 240 250
ISFLGVLLLL VCTPLGLARM FSVTGKLLVK PRLLEDLEEQ LYCSAFEEAA
260 270 280 290 300
LTRRICNPTS CWLPLDMELL HRQVLALQTQ RVLLEKRRKA SAWQRNLGYP
310 320 330 340 350
LAMLCLLVLT GLSVLIVAIH ILELLIDEAA MPRGMQGTSL GQVSFSKLGS
360 370 380 390 400
FGAVIQVVLI FYLMVSSVVG FYSSPLFRSL RPRWHDTAMT QIIGNCVCLL
410 420 430 440 450
VLSSALPVFS RTLGLTRFDL LGDFGRFNWL GNFYIVFLYN AAFAGLTTLC
460 470 480
LVKTFTAAVR AELIRAFGLD RLPLPVSGFP QASRKTQHQ
Length:489
Mass (Da):55,209
Last modified:January 10, 2006 - v2
Checksum:i80D169C977F182E2
GO
Isoform 2 (identifier: Q6UX01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-54: Missing.

Show »
Length:487
Mass (Da):54,995
Checksum:iC98C4510D10E9042
GO
Isoform 3 (identifier: Q6UX01-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-355: Missing.

Show »
Length:469
Mass (Da):53,244
Checksum:i49FB3525632D3335
GO
Isoform 4 (identifier: Q6UX01-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MEAPDYEVLS...RFKKPAEFTT → MVNVKALCEP...PETSLMTGEP

Show »
Length:484
Mass (Da):53,890
Checksum:i285F0F2180A084E5
GO
Isoform 5 (identifier: Q6UX01-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     363-393: LMVSSVVGFYSSPLFRSLRPRWHDTAMTQII → PSGNPSLPLFSKPVSWDSRPSTSWTLSPLGL
     394-489: Missing.

Note: No experimental confirmation available.
Show »
Length:393
Mass (Da):44,358
Checksum:i3F3D73D213863E3A
GO

Sequence cautioni

The sequence BAA86488 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti11V → A in BAA91811 (PubMed:14702039).Curated1
Sequence conflicti120S → P in AAQ88935 (PubMed:12975309).Curated1
Sequence conflicti157M → T in BAA91646 (PubMed:14702039).Curated1
Sequence conflicti211V → L in AAH08337 (PubMed:15489334).Curated1
Sequence conflicti334G → V in BAA91646 (PubMed:14702039).Curated1
Sequence conflicti361F → L in BAA86488 (PubMed:10574461).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0168921 – 52MEAPD…AEFTT → MVNVKALCEPEVSNCWMNVI TGTGSVSSPLLVLPQPGPET SLMTGEP in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_01689353 – 54Missing in isoform 2. 1 Publication2
Alternative sequenceiVSP_016894336 – 355Missing in isoform 3. 2 PublicationsAdd BLAST20
Alternative sequenceiVSP_016895363 – 393LMVSS…MTQII → PSGNPSLPLFSKPVSWDSRP STSWTLSPLGL in isoform 5. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_016896394 – 489Missing in isoform 5. 1 PublicationAdd BLAST96

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF260728 mRNA. Translation: AAK60600.1.
AF351620 Genomic DNA. Translation: AAK63067.1.
AB033000 mRNA. Translation: BAA86488.1. Different initiation.
AY358572 mRNA. Translation: AAQ88935.1.
AK001356 mRNA. Translation: BAA91646.1.
AK001651 mRNA. Translation: BAA91811.1.
BC008337 mRNA. Translation: AAH08337.1.
BC015015 mRNA. Translation: AAH15015.1.
BC031550 mRNA. Translation: AAH31550.1.
AL137599 mRNA. Translation: CAB70835.1.
CCDSiCCDS73466.1. [Q6UX01-3]
CCDS8780.2. [Q6UX01-1]
PIRiT46306.
RefSeqiNP_001287679.1. NM_001300750.1. [Q6UX01-4]
NP_001287680.1. NM_001300751.1. [Q6UX01-3]
NP_060583.2. NM_018113.3. [Q6UX01-1]
UniGeneiHs.272838.

Genome annotation databases

EnsembliENST00000267102; ENSP00000267102; ENSG00000139636. [Q6UX01-1]
ENST00000547382; ENSP00000447329; ENSG00000139636. [Q6UX01-3]
GeneIDi55716.
KEGGihsa:55716.
UCSCiuc001rth.5. human. [Q6UX01-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF260728 mRNA. Translation: AAK60600.1.
AF351620 Genomic DNA. Translation: AAK63067.1.
AB033000 mRNA. Translation: BAA86488.1. Different initiation.
AY358572 mRNA. Translation: AAQ88935.1.
AK001356 mRNA. Translation: BAA91646.1.
AK001651 mRNA. Translation: BAA91811.1.
BC008337 mRNA. Translation: AAH08337.1.
BC015015 mRNA. Translation: AAH15015.1.
BC031550 mRNA. Translation: AAH31550.1.
AL137599 mRNA. Translation: CAB70835.1.
CCDSiCCDS73466.1. [Q6UX01-3]
CCDS8780.2. [Q6UX01-1]
PIRiT46306.
RefSeqiNP_001287679.1. NM_001300750.1. [Q6UX01-4]
NP_001287680.1. NM_001300751.1. [Q6UX01-3]
NP_060583.2. NM_018113.3. [Q6UX01-1]
UniGeneiHs.272838.

3D structure databases

ProteinModelPortaliQ6UX01.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120838. 5 interactors.
IntActiQ6UX01. 4 interactors.
STRINGi9606.ENSP00000267102.

PTM databases

iPTMnetiQ6UX01.
PhosphoSitePlusiQ6UX01.

Polymorphism and mutation databases

BioMutaiLMBR1L.
DMDMi85681040.

Proteomic databases

MaxQBiQ6UX01.
PaxDbiQ6UX01.
PeptideAtlasiQ6UX01.
PRIDEiQ6UX01.

Protocols and materials databases

DNASUi55716.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000267102; ENSP00000267102; ENSG00000139636. [Q6UX01-1]
ENST00000547382; ENSP00000447329; ENSG00000139636. [Q6UX01-3]
GeneIDi55716.
KEGGihsa:55716.
UCSCiuc001rth.5. human. [Q6UX01-1]

Organism-specific databases

CTDi55716.
GeneCardsiLMBR1L.
H-InvDBHIX0010593.
HGNCiHGNC:18268. LMBR1L.
HPAiHPA057569.
MIMi610007. gene.
neXtProtiNX_Q6UX01.
OpenTargetsiENSG00000139636.
PharmGKBiPA142671545.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3722. Eukaryota.
ENOG410YKEX. LUCA.
GeneTreeiENSGT00390000007809.
HOVERGENiHBG072983.
InParanoidiQ6UX01.
OMAiYMEEASV.
OrthoDBiEOG091G05XM.
PhylomeDBiQ6UX01.
TreeFamiTF313485.

Miscellaneous databases

GeneWikiiLMBR1L.
GenomeRNAii55716.
PROiQ6UX01.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000139636.
CleanExiHS_LMBR1L.
ExpressionAtlasiQ6UX01. baseline and differential.
GenevisibleiQ6UX01. HS.

Family and domain databases

InterProiIPR008075. LIMR.
IPR006876. LMBR1-like_membr_prot.
[Graphical view]
PANTHERiPTHR12625. PTHR12625. 1 hit.
PfamiPF04791. LMBR1. 2 hits.
[Graphical view]
PRINTSiPR01692. LIPOCALINIMR.
ProtoNetiSearch...

Entry informationi

Entry nameiLMBRL_HUMAN
AccessioniPrimary (citable) accession number: Q6UX01
Secondary accession number(s): Q969J4
, Q96BY8, Q96HN8, Q9NT09, Q9NVE1, Q9NVU9, Q9ULP6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: November 2, 2016
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.