Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6UX01

- LMBRL_HUMAN

UniProt

Q6UX01 - LMBRL_HUMAN

Protein

Protein LMBR1L

Gene

LMBR1L

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 85 (01 Oct 2014)
      Sequence version 2 (10 Jan 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable LCN1 receptor. May mediate LCN1 endocytosis.2 Publications

    GO - Biological processi

    1. endocytosis Source: UniProtKB-KW

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Endocytosis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein LMBR1L
    Alternative name(s):
    Limb region 1 protein homolog-like
    Lipocalin-1-interacting membrane receptor
    Short name:
    Lipocalin-interacting membrane receptor
    Gene namesi
    Name:LMBR1L
    Synonyms:KIAA1174, LIMR
    ORF Names:UNQ458/PRO783
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:18268. LMBR1L.

    Subcellular locationi

    Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671545.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 489489Protein LMBR1LPRO_0000053910Add
    BLAST

    Proteomic databases

    PaxDbiQ6UX01.
    PRIDEiQ6UX01.

    Expressioni

    Tissue specificityi

    Expressed in testis, pituitary gland, adrenal gland, trachea, placenta, thymus, cerebellum, stomach, mammary gland, spinal cord. A weaker expression is detected in colon, pancreas, and prostate.1 Publication

    Developmental stagei

    Expressed in fetal kidney and lung.1 Publication

    Gene expression databases

    ArrayExpressiQ6UX01.
    BgeeiQ6UX01.
    CleanExiHS_LMBR1L.
    GenevestigatoriQ6UX01.

    Organism-specific databases

    HPAiHPA057569.

    Interactioni

    Protein-protein interaction databases

    BioGridi120838. 1 interaction.
    IntActiQ6UX01. 1 interaction.
    STRINGi9606.ENSP00000267102.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6UX01.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 2121ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini43 – 6624CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini88 – 11427ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini136 – 15419CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini176 – 19621ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini218 – 30588CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini327 – 35024ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini372 – 38817CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini410 – 43122ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini453 – 48937CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei22 – 4221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei67 – 8721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei115 – 13521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei155 – 17521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei197 – 21721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei306 – 32621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei351 – 37121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei389 – 40921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei432 – 45221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 7676LCN1-bindingAdd
    BLAST

    Sequence similaritiesi

    Belongs to the LIMR family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG246746.
    HOVERGENiHBG072983.
    InParanoidiQ6UX01.
    OMAiRVYETFT.
    OrthoDBiEOG790G68.
    PhylomeDBiQ6UX01.
    TreeFamiTF313485.

    Family and domain databases

    InterProiIPR008075. Lipcalin_1_rcpt.
    IPR006876. LMBR1-like_membr_prot.
    [Graphical view]
    PfamiPF04791. LMBR1. 1 hit.
    [Graphical view]
    PRINTSiPR01692. LIPOCALINIMR.

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6UX01-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEAPDYEVLS VREQLFHERI RECIISTLLF ATLYILCHIF LTRFKKPAEF    50
    TTVDDEDATV NKIALELCTF TLAIALGAVL LLPFSIISNE VLLSLPRNYY 100
    IQWLNGSLIH GLWNLVFLFS NLSLIFLMPF AYFFTESEGF AGSRKGVLGR 150
    VYETVVMLML LTLLVLGMVW VASAIVDKNK ANRESLYDFW EYYLPYLYSC 200
    ISFLGVLLLL VCTPLGLARM FSVTGKLLVK PRLLEDLEEQ LYCSAFEEAA 250
    LTRRICNPTS CWLPLDMELL HRQVLALQTQ RVLLEKRRKA SAWQRNLGYP 300
    LAMLCLLVLT GLSVLIVAIH ILELLIDEAA MPRGMQGTSL GQVSFSKLGS 350
    FGAVIQVVLI FYLMVSSVVG FYSSPLFRSL RPRWHDTAMT QIIGNCVCLL 400
    VLSSALPVFS RTLGLTRFDL LGDFGRFNWL GNFYIVFLYN AAFAGLTTLC 450
    LVKTFTAAVR AELIRAFGLD RLPLPVSGFP QASRKTQHQ 489
    Length:489
    Mass (Da):55,209
    Last modified:January 10, 2006 - v2
    Checksum:i80D169C977F182E2
    GO
    Isoform 2 (identifier: Q6UX01-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         53-54: Missing.

    Show »
    Length:487
    Mass (Da):54,995
    Checksum:iC98C4510D10E9042
    GO
    Isoform 3 (identifier: Q6UX01-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         336-355: Missing.

    Show »
    Length:469
    Mass (Da):53,244
    Checksum:i49FB3525632D3335
    GO
    Isoform 4 (identifier: Q6UX01-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-52: MEAPDYEVLS...RFKKPAEFTT → MVNVKALCEP...PETSLMTGEP

    Show »
    Length:484
    Mass (Da):53,890
    Checksum:i285F0F2180A084E5
    GO
    Isoform 5 (identifier: Q6UX01-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         363-393: LMVSSVVGFYSSPLFRSLRPRWHDTAMTQII → PSGNPSLPLFSKPVSWDSRPSTSWTLSPLGL
         394-489: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:393
    Mass (Da):44,358
    Checksum:i3F3D73D213863E3A
    GO

    Sequence cautioni

    The sequence BAA86488.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti11 – 111V → A in BAA91811. (PubMed:14702039)Curated
    Sequence conflicti120 – 1201S → P in AAQ88935. (PubMed:12975309)Curated
    Sequence conflicti157 – 1571M → T in BAA91646. (PubMed:14702039)Curated
    Sequence conflicti211 – 2111V → L in AAH08337. (PubMed:15489334)Curated
    Sequence conflicti334 – 3341G → V in BAA91646. (PubMed:14702039)Curated
    Sequence conflicti361 – 3611F → L in BAA86488. (PubMed:10574461)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5252MEAPD…AEFTT → MVNVKALCEPEVSNCWMNVI TGTGSVSSPLLVLPQPGPET SLMTGEP in isoform 4. 1 PublicationVSP_016892Add
    BLAST
    Alternative sequencei53 – 542Missing in isoform 2. 1 PublicationVSP_016893
    Alternative sequencei336 – 35520Missing in isoform 3. 2 PublicationsVSP_016894Add
    BLAST
    Alternative sequencei363 – 39331LMVSS…MTQII → PSGNPSLPLFSKPVSWDSRP STSWTLSPLGL in isoform 5. 1 PublicationVSP_016895Add
    BLAST
    Alternative sequencei394 – 48996Missing in isoform 5. 1 PublicationVSP_016896Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF260728 mRNA. Translation: AAK60600.1.
    AF351620 Genomic DNA. Translation: AAK63067.1.
    AB033000 mRNA. Translation: BAA86488.1. Different initiation.
    AY358572 mRNA. Translation: AAQ88935.1.
    AK001356 mRNA. Translation: BAA91646.1.
    AK001651 mRNA. Translation: BAA91811.1.
    BC008337 mRNA. Translation: AAH08337.1.
    BC015015 mRNA. Translation: AAH15015.1.
    BC031550 mRNA. Translation: AAH31550.1.
    AL137599 mRNA. Translation: CAB70835.1.
    CCDSiCCDS8780.2. [Q6UX01-1]
    PIRiT46306.
    RefSeqiNP_060583.2. NM_018113.2. [Q6UX01-1]
    XP_005269079.1. XM_005269022.1. [Q6UX01-3]
    UniGeneiHs.272838.

    Genome annotation databases

    EnsembliENST00000267102; ENSP00000267102; ENSG00000139636. [Q6UX01-1]
    ENST00000547382; ENSP00000447329; ENSG00000139636. [Q6UX01-3]
    GeneIDi55716.
    KEGGihsa:55716.
    UCSCiuc001rtg.4. human. [Q6UX01-4]
    uc001rth.4. human. [Q6UX01-1]
    uc001rti.4. human. [Q6UX01-3]
    uc009zld.1. human. [Q6UX01-5]

    Polymorphism databases

    DMDMi85681040.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF260728 mRNA. Translation: AAK60600.1 .
    AF351620 Genomic DNA. Translation: AAK63067.1 .
    AB033000 mRNA. Translation: BAA86488.1 . Different initiation.
    AY358572 mRNA. Translation: AAQ88935.1 .
    AK001356 mRNA. Translation: BAA91646.1 .
    AK001651 mRNA. Translation: BAA91811.1 .
    BC008337 mRNA. Translation: AAH08337.1 .
    BC015015 mRNA. Translation: AAH15015.1 .
    BC031550 mRNA. Translation: AAH31550.1 .
    AL137599 mRNA. Translation: CAB70835.1 .
    CCDSi CCDS8780.2. [Q6UX01-1 ]
    PIRi T46306.
    RefSeqi NP_060583.2. NM_018113.2. [Q6UX01-1 ]
    XP_005269079.1. XM_005269022.1. [Q6UX01-3 ]
    UniGenei Hs.272838.

    3D structure databases

    ProteinModelPortali Q6UX01.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120838. 1 interaction.
    IntActi Q6UX01. 1 interaction.
    STRINGi 9606.ENSP00000267102.

    Polymorphism databases

    DMDMi 85681040.

    Proteomic databases

    PaxDbi Q6UX01.
    PRIDEi Q6UX01.

    Protocols and materials databases

    DNASUi 55716.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000267102 ; ENSP00000267102 ; ENSG00000139636 . [Q6UX01-1 ]
    ENST00000547382 ; ENSP00000447329 ; ENSG00000139636 . [Q6UX01-3 ]
    GeneIDi 55716.
    KEGGi hsa:55716.
    UCSCi uc001rtg.4. human. [Q6UX01-4 ]
    uc001rth.4. human. [Q6UX01-1 ]
    uc001rti.4. human. [Q6UX01-3 ]
    uc009zld.1. human. [Q6UX01-5 ]

    Organism-specific databases

    CTDi 55716.
    GeneCardsi GC12M049490.
    H-InvDB HIX0010593.
    HGNCi HGNC:18268. LMBR1L.
    HPAi HPA057569.
    MIMi 610007. gene.
    neXtProti NX_Q6UX01.
    PharmGKBi PA142671545.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG246746.
    HOVERGENi HBG072983.
    InParanoidi Q6UX01.
    OMAi RVYETFT.
    OrthoDBi EOG790G68.
    PhylomeDBi Q6UX01.
    TreeFami TF313485.

    Miscellaneous databases

    GeneWikii LMBR1L.
    GenomeRNAii 55716.
    NextBioi 60603.
    PROi Q6UX01.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6UX01.
    Bgeei Q6UX01.
    CleanExi HS_LMBR1L.
    Genevestigatori Q6UX01.

    Family and domain databases

    InterProi IPR008075. Lipcalin_1_rcpt.
    IPR006876. LMBR1-like_membr_prot.
    [Graphical view ]
    Pfami PF04791. LMBR1. 1 hit.
    [Graphical view ]
    PRINTSi PR01692. LIPOCALINIMR.
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of a novel lipocalin-1 interacting human cell membrane receptor using phage display."
      Wojnar P., Lechner M., Merschak P., Redl B.
      J. Biol. Chem. 276:20206-20212(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 2), FUNCTION, TOPOLOGY, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE.
      Tissue: Pituitary.
    2. "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
      Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
      DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Brain.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Tissue: Teratocarcinoma.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Brain, Kidney and Uterus.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 89-489 (ISOFORMS 1/2/4).
      Tissue: Testis.
    7. "Antisense down-regulation of lipocalin-interacting membrane receptor expression inhibits cellular internalization of lipocalin-1 in human NT2 cells."
      Wojnar P., Lechner M., Redl B.
      J. Biol. Chem. 278:16209-16215(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiLMBRL_HUMAN
    AccessioniPrimary (citable) accession number: Q6UX01
    Secondary accession number(s): Q969J4
    , Q96BY8, Q96HN8, Q9NT09, Q9NVE1, Q9NVU9, Q9ULP6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 10, 2006
    Last sequence update: January 10, 2006
    Last modified: October 1, 2014
    This is version 85 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3