Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6UX01 (LMBRL_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 84. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein LMBR1L
Alternative name(s):
Limb region 1 protein homolog-like
Lipocalin-1-interacting membrane receptor
Short name=Lipocalin-interacting membrane receptor
Gene names
Name:LMBR1L
Synonyms:KIAA1174, LIMR
ORF Names:UNQ458/PRO783
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length489 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probable LCN1 receptor. May mediate LCN1 endocytosis. Ref.1 Ref.7

Subcellular location

Cell membrane; Multi-pass membrane protein Ref.1.

Tissue specificity

Expressed in testis, pituitary gland, adrenal gland, trachea, placenta, thymus, cerebellum, stomach, mammary gland, spinal cord. A weaker expression is detected in colon, pancreas, and prostate. Ref.1

Developmental stage

Expressed in fetal kidney and lung. Ref.1

Sequence similarities

Belongs to the LIMR family.

Sequence caution

The sequence BAA86488.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Biological processEndocytosis
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   Molecular functionReceptor
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processendocytosis

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6UX01-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6UX01-2)

The sequence of this isoform differs from the canonical sequence as follows:
     53-54: Missing.
Isoform 3 (identifier: Q6UX01-3)

The sequence of this isoform differs from the canonical sequence as follows:
     336-355: Missing.
Isoform 4 (identifier: Q6UX01-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MEAPDYEVLS...RFKKPAEFTT → MVNVKALCEP...PETSLMTGEP
Isoform 5 (identifier: Q6UX01-5)

The sequence of this isoform differs from the canonical sequence as follows:
     363-393: LMVSSVVGFYSSPLFRSLRPRWHDTAMTQII → PSGNPSLPLFSKPVSWDSRPSTSWTLSPLGL
     394-489: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 489489Protein LMBR1L
PRO_0000053910

Regions

Topological domain1 – 2121Extracellular Potential
Transmembrane22 – 4221Helical; Potential
Topological domain43 – 6624Cytoplasmic Potential
Transmembrane67 – 8721Helical; Potential
Topological domain88 – 11427Extracellular Potential
Transmembrane115 – 13521Helical; Potential
Topological domain136 – 15419Cytoplasmic Potential
Transmembrane155 – 17521Helical; Potential
Topological domain176 – 19621Extracellular Potential
Transmembrane197 – 21721Helical; Potential
Topological domain218 – 30588Cytoplasmic Potential
Transmembrane306 – 32621Helical; Potential
Topological domain327 – 35024Extracellular Potential
Transmembrane351 – 37121Helical; Potential
Topological domain372 – 38817Cytoplasmic Potential
Transmembrane389 – 40921Helical; Potential
Topological domain410 – 43122Extracellular Potential
Transmembrane432 – 45221Helical; Potential
Topological domain453 – 48937Cytoplasmic Potential
Region1 – 7676LCN1-binding

Natural variations

Alternative sequence1 – 5252MEAPD…AEFTT → MVNVKALCEPEVSNCWMNVI TGTGSVSSPLLVLPQPGPET SLMTGEP in isoform 4.
VSP_016892
Alternative sequence53 – 542Missing in isoform 2.
VSP_016893
Alternative sequence336 – 35520Missing in isoform 3.
VSP_016894
Alternative sequence363 – 39331LMVSS…MTQII → PSGNPSLPLFSKPVSWDSRP STSWTLSPLGL in isoform 5.
VSP_016895
Alternative sequence394 – 48996Missing in isoform 5.
VSP_016896

Experimental info

Sequence conflict111V → A in BAA91811. Ref.4
Sequence conflict1201S → P in AAQ88935. Ref.3
Sequence conflict1571M → T in BAA91646. Ref.4
Sequence conflict2111V → L in AAH08337. Ref.5
Sequence conflict3341G → V in BAA91646. Ref.4
Sequence conflict3611F → L in BAA86488. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 10, 2006. Version 2.
Checksum: 80D169C977F182E2

FASTA48955,209
        10         20         30         40         50         60 
MEAPDYEVLS VREQLFHERI RECIISTLLF ATLYILCHIF LTRFKKPAEF TTVDDEDATV 

        70         80         90        100        110        120 
NKIALELCTF TLAIALGAVL LLPFSIISNE VLLSLPRNYY IQWLNGSLIH GLWNLVFLFS 

       130        140        150        160        170        180 
NLSLIFLMPF AYFFTESEGF AGSRKGVLGR VYETVVMLML LTLLVLGMVW VASAIVDKNK 

       190        200        210        220        230        240 
ANRESLYDFW EYYLPYLYSC ISFLGVLLLL VCTPLGLARM FSVTGKLLVK PRLLEDLEEQ 

       250        260        270        280        290        300 
LYCSAFEEAA LTRRICNPTS CWLPLDMELL HRQVLALQTQ RVLLEKRRKA SAWQRNLGYP 

       310        320        330        340        350        360 
LAMLCLLVLT GLSVLIVAIH ILELLIDEAA MPRGMQGTSL GQVSFSKLGS FGAVIQVVLI 

       370        380        390        400        410        420 
FYLMVSSVVG FYSSPLFRSL RPRWHDTAMT QIIGNCVCLL VLSSALPVFS RTLGLTRFDL 

       430        440        450        460        470        480 
LGDFGRFNWL GNFYIVFLYN AAFAGLTTLC LVKTFTAAVR AELIRAFGLD RLPLPVSGFP 


QASRKTQHQ 

« Hide

Isoform 2 [UniParc].

Checksum: C98C4510D10E9042
Show »

FASTA48754,995
Isoform 3 [UniParc].

Checksum: 49FB3525632D3335
Show »

FASTA46953,244
Isoform 4 [UniParc].

Checksum: 285F0F2180A084E5
Show »

FASTA48453,890
Isoform 5 [UniParc].

Checksum: 3F3D73D213863E3A
Show »

FASTA39344,358

References

« Hide 'large scale' references
[1]"Molecular cloning of a novel lipocalin-1 interacting human cell membrane receptor using phage display."
Wojnar P., Lechner M., Merschak P., Redl B.
J. Biol. Chem. 276:20206-20212(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 2), FUNCTION, TOPOLOGY, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE.
Tissue: Pituitary.
[2]"Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
Tissue: Brain.
[3]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
Tissue: Teratocarcinoma.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Brain, Kidney and Uterus.
[6]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 89-489 (ISOFORMS 1/2/4).
Tissue: Testis.
[7]"Antisense down-regulation of lipocalin-interacting membrane receptor expression inhibits cellular internalization of lipocalin-1 in human NT2 cells."
Wojnar P., Lechner M., Redl B.
J. Biol. Chem. 278:16209-16215(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF260728 mRNA. Translation: AAK60600.1.
AF351620 Genomic DNA. Translation: AAK63067.1.
AB033000 mRNA. Translation: BAA86488.1. Different initiation.
AY358572 mRNA. Translation: AAQ88935.1.
AK001356 mRNA. Translation: BAA91646.1.
AK001651 mRNA. Translation: BAA91811.1.
BC008337 mRNA. Translation: AAH08337.1.
BC015015 mRNA. Translation: AAH15015.1.
BC031550 mRNA. Translation: AAH31550.1.
AL137599 mRNA. Translation: CAB70835.1.
CCDSCCDS8780.2. [Q6UX01-1]
PIRT46306.
RefSeqNP_060583.2. NM_018113.2. [Q6UX01-1]
XP_005269079.1. XM_005269022.1. [Q6UX01-3]
UniGeneHs.272838.

3D structure databases

ProteinModelPortalQ6UX01.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120838. 1 interaction.
IntActQ6UX01. 1 interaction.
STRING9606.ENSP00000267102.

Polymorphism databases

DMDM85681040.

Proteomic databases

PaxDbQ6UX01.
PRIDEQ6UX01.

Protocols and materials databases

DNASU55716.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000267102; ENSP00000267102; ENSG00000139636. [Q6UX01-1]
ENST00000395141; ENSP00000378573; ENSG00000139636. [Q6UX01-4]
ENST00000547382; ENSP00000447329; ENSG00000139636. [Q6UX01-3]
GeneID55716.
KEGGhsa:55716.
UCSCuc001rtg.4. human. [Q6UX01-4]
uc001rth.4. human. [Q6UX01-1]
uc001rti.4. human. [Q6UX01-3]
uc009zld.1. human. [Q6UX01-5]

Organism-specific databases

CTD55716.
GeneCardsGC12M049490.
H-InvDBHIX0010593.
HGNCHGNC:18268. LMBR1L.
HPAHPA057569.
MIM610007. gene.
neXtProtNX_Q6UX01.
PharmGKBPA142671545.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG246746.
HOVERGENHBG072983.
InParanoidQ6UX01.
OMARVYETFT.
OrthoDBEOG790G68.
PhylomeDBQ6UX01.
TreeFamTF313485.

Gene expression databases

ArrayExpressQ6UX01.
BgeeQ6UX01.
CleanExHS_LMBR1L.
GenevestigatorQ6UX01.

Family and domain databases

InterProIPR008075. Lipcalin_1_rcpt.
IPR006876. LMBR1-like_membr_prot.
[Graphical view]
PfamPF04791. LMBR1. 1 hit.
[Graphical view]
PRINTSPR01692. LIPOCALINIMR.
ProtoNetSearch...

Other

GeneWikiLMBR1L.
GenomeRNAi55716.
NextBio60603.
PROQ6UX01.
SOURCESearch...

Entry information

Entry nameLMBRL_HUMAN
AccessionPrimary (citable) accession number: Q6UX01
Secondary accession number(s): Q969J4 expand/collapse secondary AC list , Q96BY8, Q96HN8, Q9NT09, Q9NVE1, Q9NVU9, Q9ULP6
Entry history
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: July 9, 2014
This is version 84 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM