Q6UX01 (LMBRL_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein LMBR1L Alternative name(s): Limb region 1 protein homolog-like Lipocalin-1-interacting membrane receptor Short name=Lipocalin-interacting membrane receptor | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 489 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable LCN1 receptor. May mediate LCN1 endocytosis. Ref.1 Ref.7 |
| Subcellular location | |
| Tissue specificity | Expressed in testis, pituitary gland, adrenal gland, trachea, placenta, thymus, cerebellum, stomach, mammary gland, spinal cord. A weaker expression is detected in colon, pancreas, and prostate. Ref.1 |
| Developmental stage | Expressed in fetal kidney and lung. Ref.1 |
| Sequence similarities | Belongs to the LIMR family. |
| Sequence caution | The sequence BAA86488.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Endocytosis |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | endocytosis Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6UX01-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6UX01-2) The sequence of this isoform differs from the canonical sequence as follows: 53-54: Missing. | ||||||
| Isoform 3 (identifier: Q6UX01-3) The sequence of this isoform differs from the canonical sequence as follows: 336-355: Missing. | ||||||
| Isoform 4 (identifier: Q6UX01-4) The sequence of this isoform differs from the canonical sequence as follows: 1-52: MEAPDYEVLS...RFKKPAEFTT → MVNVKALCEP...PETSLMTGEP | ||||||
| Isoform 5 (identifier: Q6UX01-5) The sequence of this isoform differs from the canonical sequence as follows: 363-393: LMVSSVVGFYSSPLFRSLRPRWHDTAMTQII → PSGNPSLPLFSKPVSWDSRPSTSWTLSPLGL 394-489: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 489 | 489 | Protein LMBR1L | PRO_0000053910 | |||||
Regions | |||||||||
| Topological domain | 1 – 21 | 21 | Extracellular Potential | ||||||
| Transmembrane | 22 – 42 | 21 | Helical; Potential | ||||||
| Topological domain | 43 – 66 | 24 | Cytoplasmic Potential | ||||||
| Transmembrane | 67 – 87 | 21 | Helical; Potential | ||||||
| Topological domain | 88 – 114 | 27 | Extracellular Potential | ||||||
| Transmembrane | 115 – 135 | 21 | Helical; Potential | ||||||
| Topological domain | 136 – 154 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 155 – 175 | 21 | Helical; Potential | ||||||
| Topological domain | 176 – 196 | 21 | Extracellular Potential | ||||||
| Transmembrane | 197 – 217 | 21 | Helical; Potential | ||||||
| Topological domain | 218 – 305 | 88 | Cytoplasmic Potential | ||||||
| Transmembrane | 306 – 326 | 21 | Helical; Potential | ||||||
| Topological domain | 327 – 350 | 24 | Extracellular Potential | ||||||
| Transmembrane | 351 – 371 | 21 | Helical; Potential | ||||||
| Topological domain | 372 – 388 | 17 | Cytoplasmic Potential | ||||||
| Transmembrane | 389 – 409 | 21 | Helical; Potential | ||||||
| Topological domain | 410 – 431 | 22 | Extracellular Potential | ||||||
| Transmembrane | 432 – 452 | 21 | Helical; Potential | ||||||
| Topological domain | 453 – 489 | 37 | Cytoplasmic Potential | ||||||
| Region | 1 – 76 | 76 | LCN1-binding | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 52 | 52 | MEAPD…AEFTT → MVNVKALCEPEVSNCWMNVI TGTGSVSSPLLVLPQPGPET SLMTGEP in isoform 4. | VSP_016892 | |||||
| Alternative sequence | 53 – 54 | 2 | Missing in isoform 2. | VSP_016893 | |||||
| Alternative sequence | 336 – 355 | 20 | Missing in isoform 3. | VSP_016894 | |||||
| Alternative sequence | 363 – 393 | 31 | LMVSS…MTQII → PSGNPSLPLFSKPVSWDSRP STSWTLSPLGL in isoform 5. | VSP_016895 | |||||
| Alternative sequence | 394 – 489 | 96 | Missing in isoform 5. | VSP_016896 | |||||
Experimental info | |||||||||
| Sequence conflict | 11 | 1 | V → A in BAA91811. Ref.4 | ||||||
| Sequence conflict | 120 | 1 | S → P in AAQ88935. Ref.3 | ||||||
| Sequence conflict | 157 | 1 | M → T in BAA91646. Ref.4 | ||||||
| Sequence conflict | 211 | 1 | V → L in AAH08337. Ref.5 | ||||||
| Sequence conflict | 334 | 1 | G → V in BAA91646. Ref.4 | ||||||
| Sequence conflict | 361 | 1 | F → L in BAA86488. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of a novel lipocalin-1 interacting human cell membrane receptor using phage display." Wojnar P., Lechner M., Merschak P., Redl B. J. Biol. Chem. 276:20206-20212(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 2), FUNCTION, TOPOLOGY, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE. Tissue: Pituitary. |
| [2] | "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain." Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O. DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). Tissue: Brain. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Teratocarcinoma. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Brain, Kidney and Uterus. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 89-489 (ISOFORMS 1/2/4). Tissue: Testis. |
| [7] | "Antisense down-regulation of lipocalin-interacting membrane receptor expression inhibits cellular internalization of lipocalin-1 in human NT2 cells." Wojnar P., Lechner M., Redl B. J. Biol. Chem. 278:16209-16215(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF260728 mRNA. Translation: AAK60600.1. AF351620 Genomic DNA. Translation: AAK63067.1. AB033000 mRNA. Translation: BAA86488.1. Different initiation. AY358572 mRNA. Translation: AAQ88935.1. AK001356 mRNA. Translation: BAA91646.1. AK001651 mRNA. Translation: BAA91811.1. BC008337 mRNA. Translation: AAH08337.1. BC015015 mRNA. Translation: AAH15015.1. BC031550 mRNA. Translation: AAH31550.1. AL137599 mRNA. Translation: CAB70835.1. |
| IPI | IPI00018238. IPI00186336. IPI00386768. IPI00642776. IPI00657654. |
| PIR | T46306. |
| RefSeq | NP_060583.2. NM_018113.2. |
| UniGene | Hs.272838. |
3D structure databases | |
| ProteinModelPortal | Q6UX01. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000267102. |
Polymorphism databases | |
| DMDM | 85681040. |
Proteomic databases | |
| PaxDb | Q6UX01. |
| PRIDE | Q6UX01. |
Protocols and materials databases | |
| DNASU | 55716. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000267102; ENSP00000267102; ENSG00000139636. ENST00000395141; ENSP00000378573; ENSG00000139636. ENST00000547382; ENSP00000447329; ENSG00000139636. |
| GeneID | 55716. |
| KEGG | hsa:55716. |
| UCSC | uc001rtg.4. human. uc001rth.4. human. uc001rti.4. human. uc009zld.1. human. |
Organism-specific databases | |
| CTD | 55716. |
| GeneCards | GC12M049490. |
| H-InvDB | HIX0010593. |
| HGNC | HGNC:18268. LMBR1L. |
| MIM | 610007. gene. |
| neXtProt | NX_Q6UX01. |
| PharmGKB | PA142671545. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG246746. |
| HOVERGEN | HBG072983. |
| InParanoid | Q6UX01. |
| OMA | RVYETFT. |
| OrthoDB | EOG4XWFXS. |
| PhylomeDB | Q6UX01. |
Gene expression databases | |
| ArrayExpress | Q6UX01. |
| Bgee | Q6UX01. |
| CleanEx | HS_LMBR1L. |
| Genevestigator | Q6UX01. |
| GermOnline | ENSG00000139636. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008075. Lipcalin_1_rcpt. IPR006876. LMBR1-like_membr_prot. [Graphical view] |
| Pfam | PF04791. LMBR1. 1 hit. [Graphical view] |
| PRINTS | PR01692. LIPOCALINIMR. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 55716. |
| NextBio | 60603. |
| SOURCE | Search... |
Entry information
| Entry name | LMBRL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6UX01 Secondary accession number(s): Q969J4 Q9ULP6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
