Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6UWQ5

- LYZL1_HUMAN

UniProt

Q6UWQ5 - LYZL1_HUMAN

Protein

Lysozyme-like protein 1

Gene

LYZL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
  1. Functioni

    Catalytic activityi

    Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei54 – 541PROSITE-ProRule annotation
    Active sitei71 – 711PROSITE-ProRule annotation

    GO - Molecular functioni

    1. lysozyme activity Source: UniProtKB-EC

    GO - Biological processi

    1. cell wall macromolecule catabolic process Source: InterPro

    Keywords - Molecular functioni

    Glycosidase, Hydrolase

    Protein family/group databases

    CAZyiGH22. Glycoside Hydrolase Family 22.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Lysozyme-like protein 1 (EC:3.2.1.17)
    Gene namesi
    Name:LYZL1
    Synonyms:LYC2
    ORF Names:UNQ648/PRO1278
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:30502. LYZL1.

    Subcellular locationi

    Secreted Curated

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134868520.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1919Sequence AnalysisAdd
    BLAST
    Chaini20 – 148129Lysozyme-like protein 1PRO_0000240635Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi25 ↔ 145PROSITE-ProRule annotation
    Disulfide bondi49 ↔ 133PROSITE-ProRule annotation
    Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi83 ↔ 98PROSITE-ProRule annotation
    Disulfide bondi94 ↔ 112PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ6UWQ5.
    PRIDEiQ6UWQ5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ6UWQ5.
    BgeeiQ6UWQ5.
    CleanExiHS_LYZL1.
    GenevestigatoriQ6UWQ5.

    Organism-specific databases

    HPAiHPA052332.

    Interactioni

    Subunit structurei

    Monomer.Curated

    Protein-protein interaction databases

    STRINGi9606.ENSP00000364650.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6UWQ5.
    SMRiQ6UWQ5. Positions 20-147.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the glycosyl hydrolase 22 family.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG72851.
    HOGENOMiHOG000037357.
    HOVERGENiHBG052297.
    InParanoidiQ6UWQ5.
    KOiK01185.
    OMAiTWCRRAK.
    OrthoDBiEOG7BW0M5.
    PhylomeDBiQ6UWQ5.
    TreeFamiTF324882.

    Family and domain databases

    InterProiIPR001916. Glyco_hydro_22.
    IPR019799. Glyco_hydro_22_CS.
    IPR000974. Glyco_hydro_22_lys.
    IPR023346. Lysozyme-like_dom.
    [Graphical view]
    PfamiPF00062. Lys. 1 hit.
    [Graphical view]
    PRINTSiPR00137. LYSOZYME.
    PR00135. LYZLACT.
    SMARTiSM00263. LYZ1. 1 hit.
    [Graphical view]
    SUPFAMiSSF53955. SSF53955. 1 hit.
    PROSITEiPS00128. LACTALBUMIN_LYSOZYME_1. 1 hit.
    PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6UWQ5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKAAGILTLI GCLVTGAESK IYTRCKLAKI FSRAGLDNYW GFSLGNWICM    50
    AYYESGYNTT AQTVLDDGSI DYGIFQINSF AWCRRGKLKE NNHCHVACSA 100
    LITDDLTDAI ICARKIVKET QGMNYWQGWK KHCEGRDLSE WKKGCEVS 148
    Length:148
    Mass (Da):16,654
    Last modified:June 27, 2006 - v2
    Checksum:iAA90D3C84CB90BDA
    GO
    Isoform 2 (identifier: Q6UWQ5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRM

    Show »
    Length:194
    Mass (Da):21,568
    Checksum:i5DF874F143A12392
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Isoform 2 (identifier: Q6UWQ5-2)
    Sequence conflicti13 – 131K → R in AAH21730. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti62 – 621Q → P.2 Publications
    Corresponds to variant rs3818551 [ dbSNP | Ensembl ].
    VAR_026817

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MQDAPLSCLSPTKWSSVSSA DSTEKSASGAGTRNLPFQFC LRQALRM in isoform 2. 1 PublicationVSP_019402

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY358694 mRNA. Translation: AAQ89057.1.
    AL158167 Genomic DNA. Translation: CAI15232.1.
    BC021730 mRNA. Translation: AAH21730.1.
    CCDSiCCDS31174.1. [Q6UWQ5-2]
    RefSeqiNP_115906.3. NM_032517.4. [Q6UWQ5-2]
    UniGeneiHs.558572.

    Genome annotation databases

    EnsembliENST00000375500; ENSP00000364650; ENSG00000120563. [Q6UWQ5-2]
    GeneIDi84569.
    KEGGihsa:84569.
    UCSCiuc001iul.3. human. [Q6UWQ5-2]

    Polymorphism databases

    DMDMi109892574.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY358694 mRNA. Translation: AAQ89057.1 .
    AL158167 Genomic DNA. Translation: CAI15232.1 .
    BC021730 mRNA. Translation: AAH21730.1 .
    CCDSi CCDS31174.1. [Q6UWQ5-2 ]
    RefSeqi NP_115906.3. NM_032517.4. [Q6UWQ5-2 ]
    UniGenei Hs.558572.

    3D structure databases

    ProteinModelPortali Q6UWQ5.
    SMRi Q6UWQ5. Positions 20-147.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000364650.

    Protein family/group databases

    CAZyi GH22. Glycoside Hydrolase Family 22.

    Polymorphism databases

    DMDMi 109892574.

    Proteomic databases

    PaxDbi Q6UWQ5.
    PRIDEi Q6UWQ5.

    Protocols and materials databases

    DNASUi 84569.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000375500 ; ENSP00000364650 ; ENSG00000120563 . [Q6UWQ5-2 ]
    GeneIDi 84569.
    KEGGi hsa:84569.
    UCSCi uc001iul.3. human. [Q6UWQ5-2 ]

    Organism-specific databases

    CTDi 84569.
    GeneCardsi GC10P029618.
    H-InvDB HIX0008736.
    HGNCi HGNC:30502. LYZL1.
    HPAi HPA052332.
    neXtProti NX_Q6UWQ5.
    PharmGKBi PA134868520.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG72851.
    HOGENOMi HOG000037357.
    HOVERGENi HBG052297.
    InParanoidi Q6UWQ5.
    KOi K01185.
    OMAi TWCRRAK.
    OrthoDBi EOG7BW0M5.
    PhylomeDBi Q6UWQ5.
    TreeFami TF324882.

    Miscellaneous databases

    GenomeRNAii 84569.
    NextBioi 74460.
    PROi Q6UWQ5.

    Gene expression databases

    ArrayExpressi Q6UWQ5.
    Bgeei Q6UWQ5.
    CleanExi HS_LYZL1.
    Genevestigatori Q6UWQ5.

    Family and domain databases

    InterProi IPR001916. Glyco_hydro_22.
    IPR019799. Glyco_hydro_22_CS.
    IPR000974. Glyco_hydro_22_lys.
    IPR023346. Lysozyme-like_dom.
    [Graphical view ]
    Pfami PF00062. Lys. 1 hit.
    [Graphical view ]
    PRINTSi PR00137. LYSOZYME.
    PR00135. LYZLACT.
    SMARTi SM00263. LYZ1. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53955. SSF53955. 1 hit.
    PROSITEi PS00128. LACTALBUMIN_LYSOZYME_1. 1 hit.
    PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-62.
    2. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT PRO-62.
      Tissue: Testis.

    Entry informationi

    Entry nameiLYZL1_HUMAN
    AccessioniPrimary (citable) accession number: Q6UWQ5
    Secondary accession number(s): Q5T921, Q8WW16
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 27, 2006
    Last sequence update: June 27, 2006
    Last modified: October 1, 2014
    This is version 92 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Glycosyl hydrolases
      Classification of glycosyl hydrolase families and list of entries
    2. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3