Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lysozyme-like protein 1

Gene

LYZL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei54 – 541PROSITE-ProRule annotation
Active sitei71 – 711PROSITE-ProRule annotation

GO - Molecular functioni

  1. lysozyme activity Source: UniProtKB-EC
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Protein family/group databases

CAZyiGH22. Glycoside Hydrolase Family 22.

Names & Taxonomyi

Protein namesi
Recommended name:
Lysozyme-like protein 1 (EC:3.2.1.17)
Gene namesi
Name:LYZL1
Synonyms:LYC2
ORF Names:UNQ648/PRO1278
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:30502. LYZL1.

Subcellular locationi

Secreted Curated

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134868520.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence AnalysisAdd
BLAST
Chaini20 – 148129Lysozyme-like protein 1PRO_0000240635Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi25 ↔ 145PROSITE-ProRule annotation
Disulfide bondi49 ↔ 133PROSITE-ProRule annotation
Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi83 ↔ 98PROSITE-ProRule annotation
Disulfide bondi94 ↔ 112PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ6UWQ5.
PRIDEiQ6UWQ5.

Expressioni

Gene expression databases

BgeeiQ6UWQ5.
CleanExiHS_LYZL1.
ExpressionAtlasiQ6UWQ5. baseline and differential.
GenevestigatoriQ6UWQ5.

Organism-specific databases

HPAiHPA052332.

Interactioni

Subunit structurei

Monomer.Curated

Protein-protein interaction databases

STRINGi9606.ENSP00000364650.

Structurei

3D structure databases

ProteinModelPortaliQ6UWQ5.
SMRiQ6UWQ5. Positions 20-147.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyl hydrolase 22 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG72851.
GeneTreeiENSGT00550000074398.
HOGENOMiHOG000037357.
HOVERGENiHBG052297.
InParanoidiQ6UWQ5.
KOiK01185.
OMAiTWCRRAK.
OrthoDBiEOG7BW0M5.
PhylomeDBiQ6UWQ5.
TreeFamiTF324882.

Family and domain databases

InterProiIPR001916. Glyco_hydro_22.
IPR019799. Glyco_hydro_22_CS.
IPR000974. Glyco_hydro_22_lys.
IPR023346. Lysozyme-like_dom.
IPR030057. LYZL1/LYZL2.
[Graphical view]
PANTHERiPTHR11407:SF26. PTHR11407:SF26. 1 hit.
PfamiPF00062. Lys. 1 hit.
[Graphical view]
PRINTSiPR00137. LYSOZYME.
PR00135. LYZLACT.
SMARTiSM00263. LYZ1. 1 hit.
[Graphical view]
SUPFAMiSSF53955. SSF53955. 1 hit.
PROSITEiPS00128. LACTALBUMIN_LYSOZYME_1. 1 hit.
PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6UWQ5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKAAGILTLI GCLVTGAESK IYTRCKLAKI FSRAGLDNYW GFSLGNWICM
60 70 80 90 100
AYYESGYNTT AQTVLDDGSI DYGIFQINSF AWCRRGKLKE NNHCHVACSA
110 120 130 140
LITDDLTDAI ICARKIVKET QGMNYWQGWK KHCEGRDLSE WKKGCEVS
Length:148
Mass (Da):16,654
Last modified:June 27, 2006 - v2
Checksum:iAA90D3C84CB90BDA
GO
Isoform 2 (identifier: Q6UWQ5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRM

Show »
Length:194
Mass (Da):21,568
Checksum:i5DF874F143A12392
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform 2 (identifier: Q6UWQ5-2)
Sequence conflicti13 – 131K → R in AAH21730 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti62 – 621Q → P.2 Publications
Corresponds to variant rs3818551 [ dbSNP | Ensembl ].
VAR_026817

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MQDAPLSCLSPTKWSSVSSA DSTEKSASGAGTRNLPFQFC LRQALRM in isoform 2. 1 PublicationVSP_019402

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358694 mRNA. Translation: AAQ89057.1.
AL158167 Genomic DNA. Translation: CAI15232.1.
BC021730 mRNA. Translation: AAH21730.1.
CCDSiCCDS31174.1. [Q6UWQ5-2]
RefSeqiNP_115906.3. NM_032517.4. [Q6UWQ5-2]
UniGeneiHs.558572.

Genome annotation databases

EnsembliENST00000375500; ENSP00000364650; ENSG00000120563. [Q6UWQ5-2]
GeneIDi84569.
KEGGihsa:84569.
UCSCiuc001iul.3. human. [Q6UWQ5-2]

Polymorphism databases

DMDMi109892574.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358694 mRNA. Translation: AAQ89057.1.
AL158167 Genomic DNA. Translation: CAI15232.1.
BC021730 mRNA. Translation: AAH21730.1.
CCDSiCCDS31174.1. [Q6UWQ5-2]
RefSeqiNP_115906.3. NM_032517.4. [Q6UWQ5-2]
UniGeneiHs.558572.

3D structure databases

ProteinModelPortaliQ6UWQ5.
SMRiQ6UWQ5. Positions 20-147.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000364650.

Protein family/group databases

CAZyiGH22. Glycoside Hydrolase Family 22.

Polymorphism databases

DMDMi109892574.

Proteomic databases

PaxDbiQ6UWQ5.
PRIDEiQ6UWQ5.

Protocols and materials databases

DNASUi84569.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375500; ENSP00000364650; ENSG00000120563. [Q6UWQ5-2]
GeneIDi84569.
KEGGihsa:84569.
UCSCiuc001iul.3. human. [Q6UWQ5-2]

Organism-specific databases

CTDi84569.
GeneCardsiGC10P029618.
H-InvDBHIX0008736.
HGNCiHGNC:30502. LYZL1.
HPAiHPA052332.
neXtProtiNX_Q6UWQ5.
PharmGKBiPA134868520.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG72851.
GeneTreeiENSGT00550000074398.
HOGENOMiHOG000037357.
HOVERGENiHBG052297.
InParanoidiQ6UWQ5.
KOiK01185.
OMAiTWCRRAK.
OrthoDBiEOG7BW0M5.
PhylomeDBiQ6UWQ5.
TreeFamiTF324882.

Miscellaneous databases

GenomeRNAii84569.
NextBioi74460.
PROiQ6UWQ5.

Gene expression databases

BgeeiQ6UWQ5.
CleanExiHS_LYZL1.
ExpressionAtlasiQ6UWQ5. baseline and differential.
GenevestigatoriQ6UWQ5.

Family and domain databases

InterProiIPR001916. Glyco_hydro_22.
IPR019799. Glyco_hydro_22_CS.
IPR000974. Glyco_hydro_22_lys.
IPR023346. Lysozyme-like_dom.
IPR030057. LYZL1/LYZL2.
[Graphical view]
PANTHERiPTHR11407:SF26. PTHR11407:SF26. 1 hit.
PfamiPF00062. Lys. 1 hit.
[Graphical view]
PRINTSiPR00137. LYSOZYME.
PR00135. LYZLACT.
SMARTiSM00263. LYZ1. 1 hit.
[Graphical view]
SUPFAMiSSF53955. SSF53955. 1 hit.
PROSITEiPS00128. LACTALBUMIN_LYSOZYME_1. 1 hit.
PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-62.
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT PRO-62.
    Tissue: Testis.

Entry informationi

Entry nameiLYZL1_HUMAN
AccessioniPrimary (citable) accession number: Q6UWQ5
Secondary accession number(s): Q5T921, Q8WW16
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: March 4, 2015
This is version 95 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.