Q6UWQ5 (LYZL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Lysozyme-like protein 1 EC=3.2.1.17 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 148 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. |
| Subunit structure | Monomer Probable. |
| Subcellular location | Secreted Probable. |
| Sequence similarities | Belongs to the glycosyl hydrolase 22 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Molecular function | Glycosidase Hydrolase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell wall macromolecule catabolic process Inferred from electronic annotation. Source: InterPro |
| Cellular_component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | lysozyme activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6UWQ5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6UWQ5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Potential | ||||||||
| Chain | 20 – 148 | 129 | Lysozyme-like protein 1 | PRO_0000240635 | |||||||
Sites | |||||||||||
| Active site | 54 | 1 | By similarity | ||||||||
| Active site | 71 | 1 | By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 58 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 25 ↔ 145 | By similarity | |||||||||
| Disulfide bond | 49 ↔ 133 | By similarity | |||||||||
| Disulfide bond | 83 ↔ 98 | By similarity | |||||||||
| Disulfide bond | 94 ↔ 112 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 | 1 | M → MQDAPLSCLSPTKWSSVSSA DSTEKSASGAGTRNLPFQFC LRQALRM in isoform 2. | VSP_019402 | |||||||
| Natural variant | 62 | 1 | Q → P. Ref.1 Ref.3 Corresponds to variant rs3818551 [ dbSNP | Ensembl ]. | VAR_026817 | |||||||
Experimental info | |||||||||||
| Isoform 2: | |||||||||||
| Sequence conflict | 13 | 1 | K → R in AAH21730. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-62. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT PRO-62. Tissue: Testis. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY358694 mRNA. Translation: AAQ89057.1. AL158167 Genomic DNA. Translation: CAI15232.1. BC021730 mRNA. Translation: AAH21730.1. |
| IPI | IPI00103192. IPI00760605. |
| RefSeq | NP_115906.3. NM_032517.4. |
| UniGene | Hs.558572. |
3D structure databases | |
| ProteinModelPortal | Q6UWQ5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000364650. |
Protein family/group databases | |
| CAZy | GH22. Glycoside Hydrolase Family 22. |
Polymorphism databases | |
| DMDM | 109892574. |
Proteomic databases | |
| PaxDb | Q6UWQ5. |
| PRIDE | Q6UWQ5. |
Protocols and materials databases | |
| DNASU | 84569. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000375500; ENSP00000364650; ENSG00000120563. |
| GeneID | 84569. |
| KEGG | hsa:84569. |
| UCSC | uc001iul.3. human. |
Organism-specific databases | |
| CTD | 84569. |
| GeneCards | GC10P029618. |
| H-InvDB | HIX0008736. |
| HGNC | HGNC:30502. LYZL1. |
| HPA | HPA052332. |
| neXtProt | NX_Q6UWQ5. |
| PharmGKB | PA134868520. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG72851. |
| HOGENOM | HOG000037357. |
| HOVERGEN | HBG052297. |
| InParanoid | Q6UWQ5. |
| KO | K01185. |
| OMA | QKNHCHV. |
| OrthoDB | EOG46WZ9C. |
Gene expression databases | |
| ArrayExpress | Q6UWQ5. |
| Bgee | Q6UWQ5. |
| CleanEx | HS_LYZL1. |
| Genevestigator | Q6UWQ5. |
| GermOnline | ENSG00000120563. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001916. Glyco_hydro_22. IPR019799. Glyco_hydro_22_CS. IPR000974. Glyco_hydro_22_lys. IPR023346. Lysozyme-like_dom. [Graphical view] |
| Pfam | PF00062. Lys. 1 hit. [Graphical view] |
| PRINTS | PR00137. LYSOZYME. PR00135. LYZLACT. |
| SMART | SM00263. LYZ1. 1 hit. [Graphical view] |
| SUPFAM | SSF53955. SSF53955. 1 hit. |
| PROSITE | PS00128. LACTALBUMIN_LYSOZYME_1. 1 hit. PS51348. LACTALBUMIN_LYSOZYME_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 84569. |
| NextBio | 74460. |
Entry information
| Entry name | LYZL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6UWQ5 Secondary accession number(s): Q5T921, Q8WW16 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Glycosyl hydrolases Classification of glycosyl hydrolase families and list of entries |
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
