Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sushi domain-containing protein 1

Gene

SUSD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Sushi domain-containing protein 1
Gene namesi
Name:SUSD1
ORF Names:UNQ2438/PRO4999
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:25413. SUSD1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini30 – 721ExtracellularSequence analysisAdd BLAST692
Transmembranei722 – 742HelicalSequence analysisAdd BLAST21
Topological domaini743 – 747CytoplasmicSequence analysis5

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi64420.
OpenTargetsiENSG00000106868.
PharmGKBiPA134935587.

Polymorphism and mutation databases

DMDMi74749394.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000025197230 – 747Sushi domain-containing protein 1Add BLAST718

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi39 ↔ 48By similarity
Disulfide bondi42 ↔ 57By similarity
Disulfide bondi59 ↔ 71By similarity
Disulfide bondi77 ↔ 91By similarity
Disulfide bondi85 ↔ 100By similarity
Glycosylationi87N-linked (GlcNAc...)Sequence analysis1
Glycosylationi112N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi129 ↔ 141By similarity
Disulfide bondi135 ↔ 150By similarity
Disulfide bondi179 ↔ 221By similarity
Glycosylationi193N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi206 ↔ 234By similarity
Disulfide bondi239 ↔ 281By similarity
Glycosylationi253N-linked (GlcNAc...)1 Publication1
Disulfide bondi266 ↔ 294By similarity
Glycosylationi348N-linked (GlcNAc...)Sequence analysis1
Glycosylationi367N-linked (GlcNAc...)Sequence analysis1
Glycosylationi563N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ6UWL2.
PeptideAtlasiQ6UWL2.
PRIDEiQ6UWL2.

PTM databases

iPTMnetiQ6UWL2.
PhosphoSitePlusiQ6UWL2.

Expressioni

Gene expression databases

BgeeiENSG00000106868.
CleanExiHS_SUSD1.
ExpressionAtlasiQ6UWL2. baseline and differential.
GenevisibleiQ6UWL2. HS.

Organism-specific databases

HPAiHPA048554.

Interactioni

Protein-protein interaction databases

BioGridi122169. 12 interactors.
IntActiQ6UWL2. 3 interactors.
MINTiMINT-1194982.
STRINGi9606.ENSP00000363388.

Structurei

3D structure databases

ProteinModelPortaliQ6UWL2.
SMRiQ6UWL2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 72EGF-like 1PROSITE-ProRule annotationAdd BLAST38
Domaini73 – 112EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST40
Domaini125 – 162EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST38
Domaini177 – 236Sushi 1PROSITE-ProRule annotationAdd BLAST60
Domaini237 – 296Sushi 2PROSITE-ProRule annotationAdd BLAST60

Sequence similaritiesi

Contains 3 EGF-like domains.PROSITE-ProRule annotation
Contains 2 Sushi (CCP/SCR) domains.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal, Sushi, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IR6W. Eukaryota.
ENOG4111HTA. LUCA.
GeneTreeiENSGT00390000013892.
HOVERGENiHBG058490.
InParanoidiQ6UWL2.
OMAiSEWNKVR.
OrthoDBiEOG091G00ZC.
PhylomeDBiQ6UWL2.
TreeFamiTF335742.

Family and domain databases

CDDicd00033. CCP. 2 hits.
Gene3Di2.40.155.10. 1 hit.
InterProiIPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR023413. GFP-like.
IPR009030. Growth_fac_rcpt_.
IPR000436. Sushi_SCR_CCP_dom.
[Graphical view]
PfamiPF07645. EGF_CA. 2 hits.
PF00084. Sushi. 2 hits.
[Graphical view]
SMARTiSM00032. CCP. 2 hits.
SM00181. EGF. 3 hits.
SM00179. EGF_CA. 2 hits.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 1 hit.
SSF57535. SSF57535. 2 hits.
PROSITEiPS00010. ASX_HYDROXYL. 2 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 3 hits.
PS01187. EGF_CA. 2 hits.
PS50923. SUSHI. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6UWL2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRGPWDAGP SRRLLPLLLL LGLARGAAGA PGPDGLDVCA TCHEHATCQQ
60 70 80 90 100
REGKKICICN YGFVGNGRTQ CVDKNECQFG ATLVCGNHTS CHNTPGGFYC
110 120 130 140 150
ICLEGYRATN NNKTFIPNDG TFCTDIDECE VSGLCRHGGR CVNTHGSFEC
160 170 180 190 200
YCMDGYLPRN GPEPFHPTTD ATSCTEIDCG TPPEVPDGYI IGNYTSSLGS
210 220 230 240 250
QVRYACREGF FSVPEDTVSS CTGLGTWESP KLHCQEINCG NPPEMRHAIL
260 270 280 290 300
VGNHSSRLGG VARYVCQEGF ESPGGKITSV CTEKGTWRES TLTCTEILTK
310 320 330 340 350
INDVSLFNDT CVRWQINSRR INPKISYVIS IKGQRLDPME SVREETVNLT
360 370 380 390 400
TDSRTPEVCL ALYPGTNYTV NISTAPPRRS MPAVIGFQTA EVDLLEDDGS
410 420 430 440 450
FNISIFNETC LKLNRRSRKV GSEHMYQFTV LGQRWYLANF SHATSFNFTT
460 470 480 490 500
REQVPVVCLD LYPTTDYTVN VTLLRSPKRH SVQITIATPP AVKQTISNIS
510 520 530 540 550
GFNETCLRWR SIKTADMEEM YLFHIWGQRW YQKEFAQEMT FNISSSSRDP
560 570 580 590 600
EVCLDLRPGT NYNVSLRALS SELPVVISLT TQITEPPLPE VEFFTVHRGP
610 620 630 640 650
LPRLRLRKAK EKNGPISSYQ VLVLPLALQS TFSCDSEGAS SFFSNASDAD
660 670 680 690 700
GYVAAELLAK DVPDDAMEIP IGDRLYYGEY YNAPLKRGSD YCIILRITSE
710 720 730 740
WNKVRRHSCA VWAQVKDSSL MLLQMAGVGL GSLAVVIILT FLSFSAV
Length:747
Mass (Da):82,710
Last modified:July 5, 2004 - v1
Checksum:iF642FC18588CD974
GO
Isoform 2 (identifier: Q6UWL2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     717-747: DSSLMLLQMAGVGLGSLAVVIILTFLSFSAV → EIPCNCNFLRLHIHRANSGDTQIRHSCCCRWRVLDWVPWLL

Note: No experimental confirmation available.
Show »
Length:757
Mass (Da):84,519
Checksum:iBB52440CE72A58DB
GO
Isoform 3 (identifier: Q6UWL2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     704-721: VRRHSCAVWAQVKDSSLM → IRHSCCCRWRVLDWVPWL

Show »
Length:747
Mass (Da):82,965
Checksum:iFD98B5D693CF07F0
GO

Sequence cautioni

The sequence BAB15149 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB71259 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAI12348 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI95300 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051390201Q → E.Corresponds to variant rs17829458dbSNPEnsembl.1
Natural variantiVAR_027743524H → Q.1 PublicationCorresponds to variant rs17855713dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_026677704 – 721VRRHS…DSSLM → IRHSCCCRWRVLDWVPWL in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_020832717 – 747DSSLM…SFSAV → EIPCNCNFLRLHIHRANSGD TQIRHSCCCRWRVLDWVPWL L in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358746 mRNA. Translation: AAQ89106.1.
AK025486 mRNA. Translation: BAB15149.1. Different initiation.
AK056704 mRNA. Translation: BAB71259.1. Different initiation.
AK292868 mRNA. Translation: BAF85557.1.
AL158824, AL138756 Genomic DNA. Translation: CAI12347.2.
AL158824, AL138756 Genomic DNA. Translation: CAI12348.2. Sequence problems.
AL138756, AL158824 Genomic DNA. Translation: CAI95299.2.
AL138756, AL158824 Genomic DNA. Translation: CAI95300.2. Sequence problems.
CH471105 Genomic DNA. Translation: EAW59093.1.
BC021125 mRNA. Translation: AAH21125.1.
BC052314 mRNA. Translation: AAH52314.1.
BC060770 mRNA. Translation: AAH60770.2.
AL137432 mRNA. Translation: CAB70735.1.
CCDSiCCDS65106.1. [Q6UWL2-2]
CCDS6783.1. [Q6UWL2-1]
PIRiT46261.
RefSeqiNP_001269569.1. NM_001282640.1. [Q6UWL2-2]
NP_001269572.1. NM_001282643.1.
NP_071931.2. NM_022486.4. [Q6UWL2-1]
UniGeneiHs.494827.

Genome annotation databases

EnsembliENST00000374264; ENSP00000363382; ENSG00000106868. [Q6UWL2-2]
ENST00000374270; ENSP00000363388; ENSG00000106868. [Q6UWL2-1]
GeneIDi64420.
KEGGihsa:64420.
UCSCiuc004bfu.5. human. [Q6UWL2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358746 mRNA. Translation: AAQ89106.1.
AK025486 mRNA. Translation: BAB15149.1. Different initiation.
AK056704 mRNA. Translation: BAB71259.1. Different initiation.
AK292868 mRNA. Translation: BAF85557.1.
AL158824, AL138756 Genomic DNA. Translation: CAI12347.2.
AL158824, AL138756 Genomic DNA. Translation: CAI12348.2. Sequence problems.
AL138756, AL158824 Genomic DNA. Translation: CAI95299.2.
AL138756, AL158824 Genomic DNA. Translation: CAI95300.2. Sequence problems.
CH471105 Genomic DNA. Translation: EAW59093.1.
BC021125 mRNA. Translation: AAH21125.1.
BC052314 mRNA. Translation: AAH52314.1.
BC060770 mRNA. Translation: AAH60770.2.
AL137432 mRNA. Translation: CAB70735.1.
CCDSiCCDS65106.1. [Q6UWL2-2]
CCDS6783.1. [Q6UWL2-1]
PIRiT46261.
RefSeqiNP_001269569.1. NM_001282640.1. [Q6UWL2-2]
NP_001269572.1. NM_001282643.1.
NP_071931.2. NM_022486.4. [Q6UWL2-1]
UniGeneiHs.494827.

3D structure databases

ProteinModelPortaliQ6UWL2.
SMRiQ6UWL2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122169. 12 interactors.
IntActiQ6UWL2. 3 interactors.
MINTiMINT-1194982.
STRINGi9606.ENSP00000363388.

PTM databases

iPTMnetiQ6UWL2.
PhosphoSitePlusiQ6UWL2.

Polymorphism and mutation databases

DMDMi74749394.

Proteomic databases

PaxDbiQ6UWL2.
PeptideAtlasiQ6UWL2.
PRIDEiQ6UWL2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374264; ENSP00000363382; ENSG00000106868. [Q6UWL2-2]
ENST00000374270; ENSP00000363388; ENSG00000106868. [Q6UWL2-1]
GeneIDi64420.
KEGGihsa:64420.
UCSCiuc004bfu.5. human. [Q6UWL2-1]

Organism-specific databases

CTDi64420.
DisGeNETi64420.
GeneCardsiSUSD1.
HGNCiHGNC:25413. SUSD1.
HPAiHPA048554.
neXtProtiNX_Q6UWL2.
OpenTargetsiENSG00000106868.
PharmGKBiPA134935587.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IR6W. Eukaryota.
ENOG4111HTA. LUCA.
GeneTreeiENSGT00390000013892.
HOVERGENiHBG058490.
InParanoidiQ6UWL2.
OMAiSEWNKVR.
OrthoDBiEOG091G00ZC.
PhylomeDBiQ6UWL2.
TreeFamiTF335742.

Miscellaneous databases

GenomeRNAii64420.
PROiQ6UWL2.

Gene expression databases

BgeeiENSG00000106868.
CleanExiHS_SUSD1.
ExpressionAtlasiQ6UWL2. baseline and differential.
GenevisibleiQ6UWL2. HS.

Family and domain databases

CDDicd00033. CCP. 2 hits.
Gene3Di2.40.155.10. 1 hit.
InterProiIPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR023413. GFP-like.
IPR009030. Growth_fac_rcpt_.
IPR000436. Sushi_SCR_CCP_dom.
[Graphical view]
PfamiPF07645. EGF_CA. 2 hits.
PF00084. Sushi. 2 hits.
[Graphical view]
SMARTiSM00032. CCP. 2 hits.
SM00181. EGF. 3 hits.
SM00179. EGF_CA. 2 hits.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 1 hit.
SSF57535. SSF57535. 2 hits.
PROSITEiPS00010. ASX_HYDROXYL. 2 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 3 hits.
PS01187. EGF_CA. 2 hits.
PS50923. SUSHI. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSUSD1_HUMAN
AccessioniPrimary (citable) accession number: Q6UWL2
Secondary accession number(s): A1A4C5
, A8KA03, Q5T8V6, Q5T8V7, Q6P9G7, Q8WU83, Q96DM9, Q9H6V2, Q9NTA7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: July 5, 2004
Last modified: November 30, 2016
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.