Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM198B

Gene

FAM198B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM198B
Alternative name(s):
Expressed in nerve and epithelium during development
Gene namesi
Name:FAM198B
Synonyms:C4orf18, ENED
ORF Names:AD021, UNQ2512/PRO6001
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:25312. FAM198B.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3737CytoplasmicSequence analysisAdd
BLAST
Transmembranei38 – 5518Helical; Signal-anchor for type II membrane proteinSequence analysisAdd
BLAST
Topological domaini56 – 519464ExtracellularSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165664058.

Polymorphism and mutation databases

BioMutaiFAM198B.
DMDMi74738096.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 519519Protein FAM198BPRO_0000288864Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi289 – 2891N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ6UWH4.
PeptideAtlasiQ6UWH4.
PRIDEiQ6UWH4.

PTM databases

iPTMnetiQ6UWH4.
PhosphoSiteiQ6UWH4.

Expressioni

Gene expression databases

BgeeiQ6UWH4.
CleanExiHS_C4orf18.
ExpressionAtlasiQ6UWH4. baseline and differential.
GenevisibleiQ6UWH4. HS.

Organism-specific databases

HPAiHPA007227.

Structurei

3D structure databases

ProteinModelPortaliQ6UWH4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM198 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00420000029769.
HOGENOMiHOG000112372.
InParanoidiQ6UWH4.
OMAiKVGERPW.
OrthoDBiEOG76DTS4.
PhylomeDBiQ6UWH4.
TreeFamiTF330994.

Family and domain databases

InterProiIPR029207. FAM198.
[Graphical view]
PfamiPF15051. FAM198. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6UWH4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTCPDKPGQL INWFICSLCV PRVRKLWSSR RPRTRRNLLL GTACAIYLGF
60 70 80 90 100
LVSQVGRASL QHGQAAEKGP HRSRDTAEPS FPEIPLDGTL APPESQGNGS
110 120 130 140 150
TLQPNVVYIT LRSKRSKPAN IRGTVKPKRR KKHAVASAAP GQEALVGPSL
160 170 180 190 200
QPQEAAREAD AVAPGYAQGA NLVKIGERPW RLVRGPGVRA GGPDFLQPSS
210 220 230 240 250
RESNIRIYSE SAPSWLSKDD IRRMRLLADS AVAGLRPVSS RSGARLLVLE
260 270 280 290 300
GGAPGAVLRC GPSPCGLLKQ PLDMSEVFAF HLDRILGLNR TLPSVSRKAE
310 320 330 340 350
FIQDGRPCPI ILWDASLSSA SNDTHSSVKL TWGTYQQLLK QKCWQNGRVP
360 370 380 390 400
KPESGCTEIH HHEWSKMALF DFLLQIYNRL DTNCCGFRPR KEDACVQNGL
410 420 430 440 450
RPKCDDQGSA ALAHIIQRKH DPRHLVFIDN KGFFDRSEDN LNFKLLEGIK
460 470 480 490 500
EFPASAVSVL KSQHLRQKLL QSLFLDKVYW ESQGGRQGIE KLIDVIEHRA
510
KILITYINAH GVKVLPMNE
Length:519
Mass (Da):57,552
Last modified:July 5, 2004 - v1
Checksum:i94F6EE648E4CB0BD
GO
Isoform 2 (identifier: Q6UWH4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-329: DGRPCPIILWDASLSSASNDTHSSVK → AAAAACLSMRLAFFIFPAWEDMRVPGKCCIGHAR

Show »
Length:527
Mass (Da):58,507
Checksum:i06243CA5BD321A09
GO
Isoform 3 (identifier: Q6UWH4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-331: DGRPCPIILWDASLSSASNDTHSSVKLT → GNRFTCFVICSCWGFWFIFFFPSLSFSK
     332-519: Missing.

Note: No experimental confirmation available.
Show »
Length:331
Mass (Da):36,152
Checksum:i70CA02883C7859EB
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti432 – 4321G → S.1 Publication
Corresponds to variant rs17857283 [ dbSNP | Ensembl ].
VAR_032514

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei304 – 33128DGRPC…SVKLT → GNRFTCFVICSCWGFWFIFF FPSLSFSK in isoform 3. 1 PublicationVSP_025794Add
BLAST
Alternative sequencei304 – 32926DGRPC…HSSVK → AAAAACLSMRLAFFIFPAWE DMRVPGKCCIGHAR in isoform 2. 1 PublicationVSP_025795Add
BLAST
Alternative sequencei332 – 519188Missing in isoform 3. 1 PublicationVSP_025796Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358785 mRNA. Translation: AAQ89145.1.
AK172805 mRNA. Translation: BAD18776.1.
BC043193 mRNA. Translation: AAH43193.1.
BC100016 mRNA. Translation: AAI00017.1.
CR457196 mRNA. Translation: CAG33477.1.
CCDSiCCDS34087.1. [Q6UWH4-2]
CCDS3798.1. [Q6UWH4-1]
RefSeqiNP_001026870.2. NM_001031700.2. [Q6UWH4-2]
NP_001121896.1. NM_001128424.1. [Q6UWH4-1]
NP_057697.2. NM_016613.6. [Q6UWH4-1]
UniGeneiHs.567498.

Genome annotation databases

EnsembliENST00000296530; ENSP00000296530; ENSG00000164125. [Q6UWH4-1]
ENST00000393807; ENSP00000377396; ENSG00000164125. [Q6UWH4-2]
ENST00000585682; ENSP00000465976; ENSG00000164125. [Q6UWH4-1]
ENST00000592057; ENSP00000466873; ENSG00000164125. [Q6UWH4-3]
GeneIDi51313.
KEGGihsa:51313.
UCSCiuc003ipp.5. human. [Q6UWH4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358785 mRNA. Translation: AAQ89145.1.
AK172805 mRNA. Translation: BAD18776.1.
BC043193 mRNA. Translation: AAH43193.1.
BC100016 mRNA. Translation: AAI00017.1.
CR457196 mRNA. Translation: CAG33477.1.
CCDSiCCDS34087.1. [Q6UWH4-2]
CCDS3798.1. [Q6UWH4-1]
RefSeqiNP_001026870.2. NM_001031700.2. [Q6UWH4-2]
NP_001121896.1. NM_001128424.1. [Q6UWH4-1]
NP_057697.2. NM_016613.6. [Q6UWH4-1]
UniGeneiHs.567498.

3D structure databases

ProteinModelPortaliQ6UWH4.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiQ6UWH4.
PhosphoSiteiQ6UWH4.

Polymorphism and mutation databases

BioMutaiFAM198B.
DMDMi74738096.

Proteomic databases

MaxQBiQ6UWH4.
PeptideAtlasiQ6UWH4.
PRIDEiQ6UWH4.

Protocols and materials databases

DNASUi51313.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296530; ENSP00000296530; ENSG00000164125. [Q6UWH4-1]
ENST00000393807; ENSP00000377396; ENSG00000164125. [Q6UWH4-2]
ENST00000585682; ENSP00000465976; ENSG00000164125. [Q6UWH4-1]
ENST00000592057; ENSP00000466873; ENSG00000164125. [Q6UWH4-3]
GeneIDi51313.
KEGGihsa:51313.
UCSCiuc003ipp.5. human. [Q6UWH4-1]

Organism-specific databases

CTDi51313.
GeneCardsiFAM198B.
HGNCiHGNC:25312. FAM198B.
HPAiHPA007227.
neXtProtiNX_Q6UWH4.
PharmGKBiPA165664058.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00420000029769.
HOGENOMiHOG000112372.
InParanoidiQ6UWH4.
OMAiKVGERPW.
OrthoDBiEOG76DTS4.
PhylomeDBiQ6UWH4.
TreeFamiTF330994.

Miscellaneous databases

ChiTaRSiFAM198B. human.
GeneWikiiC4orf18.
GenomeRNAii51313.
PROiQ6UWH4.

Gene expression databases

BgeeiQ6UWH4.
CleanExiHS_C4orf18.
ExpressionAtlasiQ6UWH4. baseline and differential.
GenevisibleiQ6UWH4. HS.

Family and domain databases

InterProiIPR029207. FAM198.
[Graphical view]
PfamiPF15051. FAM198. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 238-519 (ISOFORM 1), VARIANT SER-432.
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 274-519 (ISOFORM 1).
    Tissue: Testis.
  5. "Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing."
    Simpson J.C., Wellenreuther R., Poustka A., Pepperkok R., Wiemann S.
    EMBO Rep. 1:287-292(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiF198B_HUMAN
AccessioniPrimary (citable) accession number: Q6UWH4
Secondary accession number(s): Q498Z3
, Q6IAF9, Q6ZMF2, Q86XL0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: July 5, 2004
Last modified: July 6, 2016
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.