Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6UWF3 (SCIMP_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 74. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
SLP adapter and CSK-interacting membrane protein
Alternative name(s):
SLP65/SLP76, Csk-interacting membrane protein
Gene names
Name:SCIMP
Synonyms:C17orf87
ORF Names:UNQ5783/PRO16090
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length145 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Lipid tetraspanin-associated transmembrane adapter/mediator involved in major histocompatibility complex (MHC) class II signaling transduction. Required in generating the calcium response and enhancing ERK activity upon MHC-II stimulation. Ref.7

Subunit structure

Interacts with CD37, CD53 and CD81. Interacts with BLNK and GRB2 isoform 1. Interacts (via prolin-rich region) with LYN (via SH3 domain). Interacts with CSK (via SH2 domain). Ref.7

Subcellular location

Membrane; Single-pass membrane protein Potential. Membrane; Lipid-anchor. Note: Together with MHC-II, associates with lipid-enriched microdomains called tetraspanin-enriched microdomains (TEMs). Rapidly translocates into immunological synapse (IS) at cell-cell contacts between antigen-presenting cells (APCs) and T-cells. Colocalized with tetraspanins CD37, CD53, and CD81 at the uropod. Present at regions of cell-cell contacts but also at the leading edge of migrating cells. Ref.7

Tissue specificity

Expressed in antigen-presenting cells, like peripheral blood leukocytes and monocyte-derived dendritic cells (MDDC) (at protein level). Highly expressed in lymph nodes and spleen. Expressed in antigen-presenting cells. Faintly expressed in the majority of nonimmune system tissues. Ref.7

Post-translational modification

Phosphorylated. Phosphorylation occurs on tyrosine residues by tyrosine-protein kinases LYN and SRC upon MHC-II stimulation. Ref.7

Palmitoylated. Ref.7

Caution

It is uncertain whether Met-1 or Met-12 is the initiator.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6UWF3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6UWF3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     43-49: Missing.
     95-130: SPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDD → YGVLLCHPGWSAMARSRLTASSASRVHAILLPQPPE
     131-145: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q6UWF3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     43-49: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 145145SLP adapter and CSK-interacting membrane protein
PRO_0000295237

Regions

Transmembrane19 – 3921Helical; Potential
Compositional bias57 – 13781Pro-rich

Amino acid modifications

Modified residue761Phosphoserine By similarity
Modified residue1311Phosphotyrosine By similarity
Lipidation401S-palmitoyl cysteine Probable
Lipidation421S-palmitoyl cysteine Probable

Natural variations

Alternative sequence43 – 497Missing in isoform 2 and isoform 3.
VSP_026853
Alternative sequence95 – 13036SPQEA…EPEDD → YGVLLCHPGWSAMARSRLTA SSASRVHAILLPQPPE in isoform 2.
VSP_026854
Alternative sequence131 – 14515Missing in isoform 2.
VSP_026855

Experimental info

Mutagenesis691Y → F: Inhibits interaction with GRB2. Ref.7
Mutagenesis1071Y → F: Inhibits interaction with CSK. Stimulates activation of several downstream signaling pathways. Ref.7
Mutagenesis1311Y → F: Inhibits interaction with BLNK. Inhibits activation of several downstream signaling pathways. Ref.7

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 8093F1087A7428EF

FASTA14516,618
        10         20         30         40         50         60 
MDTFTVQDST AMSWWRNNFW IILAVAIIVV SVGLGLILYC VCKWQLRRGK KWEIAKPLKH 

        70         80         90        100        110        120 
KQVDEEKMYE NVLNESPVQL PPLPPRNWPS LEDSSPQEAP SQPPATYSLV NKVKNKKTVS 

       130        140 
IPSYIEPEDD YDDVEIPANT EKASF 

« Hide

Isoform 2 [UniParc].

Checksum: 428E197CD758F717
Show »

FASTA12313,927
Isoform 3 [UniParc].

Checksum: B782EA12EEF75192
Show »

FASTA13815,693

References

« Hide 'large scale' references
[1]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Spleen and Umbilical cord blood.
[3]"A computer system platform used to predict novel genes."
Yu Z., Zheng Z., Tang T., Fu Y.
Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
[4]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Brain.
[7]"SCIMP, a transmembrane adapter protein involved in major histocompatibility complex class II signaling."
Draber P., Vonkova I., Stepanek O., Hrdinka M., Kucova M., Skopcova T., Otahal P., Angelisova P., Horejsi V., Yeung M., Weiss A., Brdicka T.
Mol. Cell. Biol. 31:4550-4562(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH BLNK; CD37; CD53; CD81; CSK AND LYN, PALMITOYLATION AT CYS-40 AND CYS-42, PHOSPHORYLATION, MUTAGENESIS OF TYR-69; TYR-107 AND TYR-131, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY358809 mRNA. Translation: AAQ89169.1.
AK057142 mRNA. No translation available.
AK297035 mRNA. Translation: BAG59563.1.
DQ778084 mRNA. Translation: ABI63348.1.
AC087500 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90349.1.
CH471108 Genomic DNA. Translation: EAW90350.1.
BC127925 mRNA. Translation: AAI27926.1.
BC130554 mRNA. Translation: AAI30555.1.
BC130556 mRNA. Translation: AAI30557.1.
BC144395 mRNA. Translation: AAI44396.1.
CCDSCCDS42242.1. [Q6UWF3-1]
RefSeqNP_001258771.1. NM_001271842.1. [Q6UWF3-3]
NP_996986.1. NM_207103.3. [Q6UWF3-1]
XP_005256688.1. XM_005256631.2. [Q6UWF3-2]
UniGeneHs.462080.

3D structure databases

ProteinModelPortalQ6UWF3.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid132643. 1 interaction.
IntActQ6UWF3. 1 interaction.

PTM databases

PhosphoSiteQ6UWF3.

Polymorphism databases

DMDM74738081.

Proteomic databases

PRIDEQ6UWF3.

Protocols and materials databases

DNASU388325.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000399600; ENSP00000382509; ENSG00000161929.
ENST00000571800; ENSP00000459605; ENSG00000161929. [Q6UWF3-2]
ENST00000574081; ENSP00000461269; ENSG00000161929. [Q6UWF3-1]
GeneID388325.
KEGGhsa:388325.
UCSCuc002gbh.3. human. [Q6UWF3-1]
uc002gbi.3. human. [Q6UWF3-2]

Organism-specific databases

CTD388325.
GeneCardsGC17M005113.
H-InvDBHIX0013465.
HGNCHGNC:33504. SCIMP.
HPAHPA006117.
MIM614406. gene.
neXtProtNX_Q6UWF3.
PharmGKBPA162378517.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG75277.
HOGENOMHOG000015337.
HOVERGENHBG099534.
OMAPSYIEPE.
OrthoDBEOG7X3QT6.
PhylomeDBQ6UWF3.
TreeFamTF340362.

Gene expression databases

BgeeQ6UWF3.
CleanExHS_C17orf87.
GenevestigatorQ6UWF3.

Family and domain databases

InterProIPR028181. SCIMP.
[Graphical view]
PfamPF15050. SCIMP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi388325.
NextBio101958.
PROQ6UWF3.
SOURCESearch...

Entry information

Entry nameSCIMP_HUMAN
AccessionPrimary (citable) accession number: Q6UWF3
Secondary accession number(s): A6XGL4, B4DLK1, Q96MD0
Entry history
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 5, 2004
Last modified: July 9, 2014
This is version 74 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM