Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6UWF3

- SCIMP_HUMAN

UniProt

Q6UWF3 - SCIMP_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

SLP adapter and CSK-interacting membrane protein

Gene

SCIMP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Lipid tetraspanin-associated transmembrane adapter/mediator involved in major histocompatibility complex (MHC) class II signaling transduction. Required in generating the calcium response and enhancing ERK activity upon MHC-II stimulation.1 Publication

GO - Biological processi

  1. positive regulation of ERK1 and ERK2 cascade Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
SLP adapter and CSK-interacting membrane protein
Alternative name(s):
SLP65/SLP76, Csk-interacting membrane protein
Gene namesi
Name:SCIMP
Synonyms:C17orf87
ORF Names:UNQ5783/PRO16090
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:33504. SCIMP.

Subcellular locationi

Membrane Curated; Single-pass membrane protein Curated. Membrane 1 Publication; Lipid-anchor 1 Publication
Note: Together with MHC-II, associates with lipid-enriched microdomains called tetraspanin-enriched microdomains (TEMs). Rapidly translocates into immunological synapse (IS) at cell-cell contacts between antigen-presenting cells (APCs) and T-cells. Colocalized with tetraspanins CD37, CD53, and CD81 at the uropod. Present at regions of cell-cell contacts but also at the leading edge of migrating cells.

GO - Cellular componenti

  1. immunological synapse Source: UniProtKB
  2. integral component of membrane Source: UniProtKB-KW
  3. leading edge membrane Source: UniProtKB
  4. membrane Source: UniProtKB
  5. tetraspanin-enriched microdomain Source: UniProtKB
  6. uropod membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi69 – 691Y → F: Inhibits interaction with GRB2. 1 Publication
Mutagenesisi107 – 1071Y → F: Inhibits interaction with CSK. Stimulates activation of several downstream signaling pathways. 1 Publication
Mutagenesisi131 – 1311Y → F: Inhibits interaction with BLNK. Inhibits activation of several downstream signaling pathways. 1 Publication

Organism-specific databases

PharmGKBiPA162378517.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 145145SLP adapter and CSK-interacting membrane proteinPRO_0000295237Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi40 – 401S-palmitoyl cysteine1 Publication
Lipidationi42 – 421S-palmitoyl cysteine1 Publication
Modified residuei76 – 761PhosphoserineBy similarity
Modified residuei131 – 1311PhosphotyrosineBy similarity

Post-translational modificationi

Phosphorylated. Phosphorylation occurs on tyrosine residues by tyrosine-protein kinases LYN and SRC upon MHC-II stimulation.1 Publication
Palmitoylated.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PRIDEiQ6UWF3.

PTM databases

PhosphoSiteiQ6UWF3.

Expressioni

Tissue specificityi

Expressed in antigen-presenting cells, like peripheral blood leukocytes and monocyte-derived dendritic cells (MDDC) (at protein level). Highly expressed in lymph nodes and spleen. Expressed in antigen-presenting cells. Faintly expressed in the majority of nonimmune system tissues.1 Publication

Gene expression databases

BgeeiQ6UWF3.
CleanExiHS_C17orf87.
ExpressionAtlasiQ6UWF3. baseline and differential.
GenevestigatoriQ6UWF3.

Organism-specific databases

HPAiHPA006117.

Interactioni

Subunit structurei

Interacts with CD37, CD53 and CD81. Interacts with BLNK and GRB2 isoform 1. Interacts (via prolin-rich region) with LYN (via SH3 domain). Interacts with CSK (via SH2 domain).1 Publication

Protein-protein interaction databases

BioGridi132643. 1 interaction.
IntActiQ6UWF3. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ6UWF3.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei19 – 3921HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi57 – 13781Pro-richAdd
BLAST

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG75277.
GeneTreeiENSGT00390000007003.
HOGENOMiHOG000015337.
HOVERGENiHBG099534.
InParanoidiQ6UWF3.
OMAiPSYIEPE.
OrthoDBiEOG7X3QT6.
PhylomeDBiQ6UWF3.
TreeFamiTF340362.

Family and domain databases

InterProiIPR028181. SCIMP.
[Graphical view]
PfamiPF15050. SCIMP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6UWF3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDTFTVQDST AMSWWRNNFW IILAVAIIVV SVGLGLILYC VCKWQLRRGK
60 70 80 90 100
KWEIAKPLKH KQVDEEKMYE NVLNESPVQL PPLPPRNWPS LEDSSPQEAP
110 120 130 140
SQPPATYSLV NKVKNKKTVS IPSYIEPEDD YDDVEIPANT EKASF
Length:145
Mass (Da):16,618
Last modified:July 5, 2004 - v1
Checksum:i8093F1087A7428EF
GO
Isoform 2 (identifier: Q6UWF3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-49: Missing.
     95-130: SPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDD → YGVLLCHPGWSAMARSRLTASSASRVHAILLPQPPE
     131-145: Missing.

Note: No experimental confirmation available.

Show »
Length:123
Mass (Da):13,927
Checksum:i428E197CD758F717
GO
Isoform 3 (identifier: Q6UWF3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-49: Missing.

Show »
Length:138
Mass (Da):15,693
Checksum:iB782EA12EEF75192
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei43 – 497Missing in isoform 2 and isoform 3. 3 PublicationsVSP_026853
Alternative sequencei95 – 13036SPQEA…EPEDD → YGVLLCHPGWSAMARSRLTA SSASRVHAILLPQPPE in isoform 2. 1 PublicationVSP_026854Add
BLAST
Alternative sequencei131 – 14515Missing in isoform 2. 1 PublicationVSP_026855Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY358809 mRNA. Translation: AAQ89169.1.
AK057142 mRNA. No translation available.
AK297035 mRNA. Translation: BAG59563.1.
DQ778084 mRNA. Translation: ABI63348.1.
AC087500 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90349.1.
CH471108 Genomic DNA. Translation: EAW90350.1.
BC127925 mRNA. Translation: AAI27926.1.
BC130554 mRNA. Translation: AAI30555.1.
BC130556 mRNA. Translation: AAI30557.1.
BC144395 mRNA. Translation: AAI44396.1.
CCDSiCCDS42242.1. [Q6UWF3-1]
CCDS62044.1. [Q6UWF3-3]
RefSeqiNP_001258771.1. NM_001271842.1. [Q6UWF3-3]
NP_996986.1. NM_207103.3. [Q6UWF3-1]
XP_005256688.1. XM_005256631.2. [Q6UWF3-2]
UniGeneiHs.462080.

Genome annotation databases

EnsembliENST00000399600; ENSP00000382509; ENSG00000161929. [Q6UWF3-3]
ENST00000571800; ENSP00000459605; ENSG00000161929. [Q6UWF3-2]
ENST00000574081; ENSP00000461269; ENSG00000161929. [Q6UWF3-1]
GeneIDi388325.
KEGGihsa:388325.
UCSCiuc002gbh.3. human. [Q6UWF3-1]
uc002gbi.3. human. [Q6UWF3-2]
uc010clb.2. human.

Polymorphism databases

DMDMi74738081.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY358809 mRNA. Translation: AAQ89169.1 .
AK057142 mRNA. No translation available.
AK297035 mRNA. Translation: BAG59563.1 .
DQ778084 mRNA. Translation: ABI63348.1 .
AC087500 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90349.1 .
CH471108 Genomic DNA. Translation: EAW90350.1 .
BC127925 mRNA. Translation: AAI27926.1 .
BC130554 mRNA. Translation: AAI30555.1 .
BC130556 mRNA. Translation: AAI30557.1 .
BC144395 mRNA. Translation: AAI44396.1 .
CCDSi CCDS42242.1. [Q6UWF3-1 ]
CCDS62044.1. [Q6UWF3-3 ]
RefSeqi NP_001258771.1. NM_001271842.1. [Q6UWF3-3 ]
NP_996986.1. NM_207103.3. [Q6UWF3-1 ]
XP_005256688.1. XM_005256631.2. [Q6UWF3-2 ]
UniGenei Hs.462080.

3D structure databases

ProteinModelPortali Q6UWF3.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 132643. 1 interaction.
IntActi Q6UWF3. 1 interaction.

PTM databases

PhosphoSitei Q6UWF3.

Polymorphism databases

DMDMi 74738081.

Proteomic databases

PRIDEi Q6UWF3.

Protocols and materials databases

DNASUi 388325.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000399600 ; ENSP00000382509 ; ENSG00000161929 . [Q6UWF3-3 ]
ENST00000571800 ; ENSP00000459605 ; ENSG00000161929 . [Q6UWF3-2 ]
ENST00000574081 ; ENSP00000461269 ; ENSG00000161929 . [Q6UWF3-1 ]
GeneIDi 388325.
KEGGi hsa:388325.
UCSCi uc002gbh.3. human. [Q6UWF3-1 ]
uc002gbi.3. human. [Q6UWF3-2 ]
uc010clb.2. human.

Organism-specific databases

CTDi 388325.
GeneCardsi GC17M005113.
H-InvDB HIX0013465.
HGNCi HGNC:33504. SCIMP.
HPAi HPA006117.
MIMi 614406. gene.
neXtProti NX_Q6UWF3.
PharmGKBi PA162378517.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG75277.
GeneTreei ENSGT00390000007003.
HOGENOMi HOG000015337.
HOVERGENi HBG099534.
InParanoidi Q6UWF3.
OMAi PSYIEPE.
OrthoDBi EOG7X3QT6.
PhylomeDBi Q6UWF3.
TreeFami TF340362.

Miscellaneous databases

GenomeRNAii 388325.
NextBioi 101958.
PROi Q6UWF3.
SOURCEi Search...

Gene expression databases

Bgeei Q6UWF3.
CleanExi HS_C17orf87.
ExpressionAtlasi Q6UWF3. baseline and differential.
Genevestigatori Q6UWF3.

Family and domain databases

InterProi IPR028181. SCIMP.
[Graphical view ]
Pfami PF15050. SCIMP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Spleen and Umbilical cord blood.
  3. "A computer system platform used to predict novel genes."
    Yu Z., Zheng Z., Tang T., Fu Y.
    Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Brain.
  7. "SCIMP, a transmembrane adapter protein involved in major histocompatibility complex class II signaling."
    Draber P., Vonkova I., Stepanek O., Hrdinka M., Kucova M., Skopcova T., Otahal P., Angelisova P., Horejsi V., Yeung M., Weiss A., Brdicka T.
    Mol. Cell. Biol. 31:4550-4562(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH BLNK; CD37; CD53; CD81; CSK AND LYN, PALMITOYLATION AT CYS-40 AND CYS-42, PHOSPHORYLATION, MUTAGENESIS OF TYR-69; TYR-107 AND TYR-131, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiSCIMP_HUMAN
AccessioniPrimary (citable) accession number: Q6UWF3
Secondary accession number(s): A6XGL4, B4DLK1, Q96MD0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 5, 2004
Last modified: October 29, 2014
This is version 77 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3