Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6UWF3

- SCIMP_HUMAN

UniProt

Q6UWF3 - SCIMP_HUMAN

Protein

SLP adapter and CSK-interacting membrane protein

Gene

SCIMP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Lipid tetraspanin-associated transmembrane adapter/mediator involved in major histocompatibility complex (MHC) class II signaling transduction. Required in generating the calcium response and enhancing ERK activity upon MHC-II stimulation.1 Publication

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. positive regulation of ERK1 and ERK2 cascade Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SLP adapter and CSK-interacting membrane protein
    Alternative name(s):
    SLP65/SLP76, Csk-interacting membrane protein
    Gene namesi
    Name:SCIMP
    Synonyms:C17orf87
    ORF Names:UNQ5783/PRO16090
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:33504. SCIMP.

    Subcellular locationi

    Membrane Curated; Single-pass membrane protein Curated. Membrane 1 Publication; Lipid-anchor 1 Publication
    Note: Together with MHC-II, associates with lipid-enriched microdomains called tetraspanin-enriched microdomains (TEMs). Rapidly translocates into immunological synapse (IS) at cell-cell contacts between antigen-presenting cells (APCs) and T-cells. Colocalized with tetraspanins CD37, CD53, and CD81 at the uropod. Present at regions of cell-cell contacts but also at the leading edge of migrating cells.

    GO - Cellular componenti

    1. immunological synapse Source: UniProtKB
    2. integral component of membrane Source: UniProtKB-KW
    3. leading edge membrane Source: UniProtKB
    4. membrane Source: UniProtKB
    5. tetraspanin-enriched microdomain Source: UniProtKB
    6. uropod membrane Source: UniProtKB

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi69 – 691Y → F: Inhibits interaction with GRB2. 1 Publication
    Mutagenesisi107 – 1071Y → F: Inhibits interaction with CSK. Stimulates activation of several downstream signaling pathways. 1 Publication
    Mutagenesisi131 – 1311Y → F: Inhibits interaction with BLNK. Inhibits activation of several downstream signaling pathways. 1 Publication

    Organism-specific databases

    PharmGKBiPA162378517.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 145145SLP adapter and CSK-interacting membrane proteinPRO_0000295237Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi40 – 401S-palmitoyl cysteine1 Publication
    Lipidationi42 – 421S-palmitoyl cysteine1 Publication
    Modified residuei76 – 761PhosphoserineBy similarity
    Modified residuei131 – 1311PhosphotyrosineBy similarity

    Post-translational modificationi

    Phosphorylated. Phosphorylation occurs on tyrosine residues by tyrosine-protein kinases LYN and SRC upon MHC-II stimulation.1 Publication
    Palmitoylated.1 Publication

    Keywords - PTMi

    Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    PRIDEiQ6UWF3.

    PTM databases

    PhosphoSiteiQ6UWF3.

    Expressioni

    Tissue specificityi

    Expressed in antigen-presenting cells, like peripheral blood leukocytes and monocyte-derived dendritic cells (MDDC) (at protein level). Highly expressed in lymph nodes and spleen. Expressed in antigen-presenting cells. Faintly expressed in the majority of nonimmune system tissues.1 Publication

    Gene expression databases

    BgeeiQ6UWF3.
    CleanExiHS_C17orf87.
    GenevestigatoriQ6UWF3.

    Organism-specific databases

    HPAiHPA006117.

    Interactioni

    Subunit structurei

    Interacts with CD37, CD53 and CD81. Interacts with BLNK and GRB2 isoform 1. Interacts (via prolin-rich region) with LYN (via SH3 domain). Interacts with CSK (via SH2 domain).1 Publication

    Protein-protein interaction databases

    BioGridi132643. 1 interaction.
    IntActiQ6UWF3. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6UWF3.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei19 – 3921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi57 – 13781Pro-richAdd
    BLAST

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG75277.
    HOGENOMiHOG000015337.
    HOVERGENiHBG099534.
    OMAiPSYIEPE.
    OrthoDBiEOG7X3QT6.
    PhylomeDBiQ6UWF3.
    TreeFamiTF340362.

    Family and domain databases

    InterProiIPR028181. SCIMP.
    [Graphical view]
    PfamiPF15050. SCIMP. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6UWF3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDTFTVQDST AMSWWRNNFW IILAVAIIVV SVGLGLILYC VCKWQLRRGK    50
    KWEIAKPLKH KQVDEEKMYE NVLNESPVQL PPLPPRNWPS LEDSSPQEAP 100
    SQPPATYSLV NKVKNKKTVS IPSYIEPEDD YDDVEIPANT EKASF 145
    Length:145
    Mass (Da):16,618
    Last modified:July 5, 2004 - v1
    Checksum:i8093F1087A7428EF
    GO
    Isoform 2 (identifier: Q6UWF3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         43-49: Missing.
         95-130: SPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDD → YGVLLCHPGWSAMARSRLTASSASRVHAILLPQPPE
         131-145: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:123
    Mass (Da):13,927
    Checksum:i428E197CD758F717
    GO
    Isoform 3 (identifier: Q6UWF3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         43-49: Missing.

    Show »
    Length:138
    Mass (Da):15,693
    Checksum:iB782EA12EEF75192
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei43 – 497Missing in isoform 2 and isoform 3. 3 PublicationsVSP_026853
    Alternative sequencei95 – 13036SPQEA…EPEDD → YGVLLCHPGWSAMARSRLTA SSASRVHAILLPQPPE in isoform 2. 1 PublicationVSP_026854Add
    BLAST
    Alternative sequencei131 – 14515Missing in isoform 2. 1 PublicationVSP_026855Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY358809 mRNA. Translation: AAQ89169.1.
    AK057142 mRNA. No translation available.
    AK297035 mRNA. Translation: BAG59563.1.
    DQ778084 mRNA. Translation: ABI63348.1.
    AC087500 Genomic DNA. No translation available.
    CH471108 Genomic DNA. Translation: EAW90349.1.
    CH471108 Genomic DNA. Translation: EAW90350.1.
    BC127925 mRNA. Translation: AAI27926.1.
    BC130554 mRNA. Translation: AAI30555.1.
    BC130556 mRNA. Translation: AAI30557.1.
    BC144395 mRNA. Translation: AAI44396.1.
    CCDSiCCDS42242.1. [Q6UWF3-1]
    CCDS62044.1. [Q6UWF3-3]
    RefSeqiNP_001258771.1. NM_001271842.1. [Q6UWF3-3]
    NP_996986.1. NM_207103.3. [Q6UWF3-1]
    XP_005256688.1. XM_005256631.2. [Q6UWF3-2]
    UniGeneiHs.462080.

    Genome annotation databases

    EnsembliENST00000399600; ENSP00000382509; ENSG00000161929. [Q6UWF3-3]
    ENST00000571800; ENSP00000459605; ENSG00000161929. [Q6UWF3-2]
    ENST00000574081; ENSP00000461269; ENSG00000161929. [Q6UWF3-1]
    GeneIDi388325.
    KEGGihsa:388325.
    UCSCiuc002gbh.3. human. [Q6UWF3-1]
    uc002gbi.3. human. [Q6UWF3-2]
    uc010clb.2. human.

    Polymorphism databases

    DMDMi74738081.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY358809 mRNA. Translation: AAQ89169.1 .
    AK057142 mRNA. No translation available.
    AK297035 mRNA. Translation: BAG59563.1 .
    DQ778084 mRNA. Translation: ABI63348.1 .
    AC087500 Genomic DNA. No translation available.
    CH471108 Genomic DNA. Translation: EAW90349.1 .
    CH471108 Genomic DNA. Translation: EAW90350.1 .
    BC127925 mRNA. Translation: AAI27926.1 .
    BC130554 mRNA. Translation: AAI30555.1 .
    BC130556 mRNA. Translation: AAI30557.1 .
    BC144395 mRNA. Translation: AAI44396.1 .
    CCDSi CCDS42242.1. [Q6UWF3-1 ]
    CCDS62044.1. [Q6UWF3-3 ]
    RefSeqi NP_001258771.1. NM_001271842.1. [Q6UWF3-3 ]
    NP_996986.1. NM_207103.3. [Q6UWF3-1 ]
    XP_005256688.1. XM_005256631.2. [Q6UWF3-2 ]
    UniGenei Hs.462080.

    3D structure databases

    ProteinModelPortali Q6UWF3.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 132643. 1 interaction.
    IntActi Q6UWF3. 1 interaction.

    PTM databases

    PhosphoSitei Q6UWF3.

    Polymorphism databases

    DMDMi 74738081.

    Proteomic databases

    PRIDEi Q6UWF3.

    Protocols and materials databases

    DNASUi 388325.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000399600 ; ENSP00000382509 ; ENSG00000161929 . [Q6UWF3-3 ]
    ENST00000571800 ; ENSP00000459605 ; ENSG00000161929 . [Q6UWF3-2 ]
    ENST00000574081 ; ENSP00000461269 ; ENSG00000161929 . [Q6UWF3-1 ]
    GeneIDi 388325.
    KEGGi hsa:388325.
    UCSCi uc002gbh.3. human. [Q6UWF3-1 ]
    uc002gbi.3. human. [Q6UWF3-2 ]
    uc010clb.2. human.

    Organism-specific databases

    CTDi 388325.
    GeneCardsi GC17M005113.
    H-InvDB HIX0013465.
    HGNCi HGNC:33504. SCIMP.
    HPAi HPA006117.
    MIMi 614406. gene.
    neXtProti NX_Q6UWF3.
    PharmGKBi PA162378517.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG75277.
    HOGENOMi HOG000015337.
    HOVERGENi HBG099534.
    OMAi PSYIEPE.
    OrthoDBi EOG7X3QT6.
    PhylomeDBi Q6UWF3.
    TreeFami TF340362.

    Miscellaneous databases

    GenomeRNAii 388325.
    NextBioi 101958.
    PROi Q6UWF3.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q6UWF3.
    CleanExi HS_C17orf87.
    Genevestigatori Q6UWF3.

    Family and domain databases

    InterProi IPR028181. SCIMP.
    [Graphical view ]
    Pfami PF15050. SCIMP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Spleen and Umbilical cord blood.
    3. "A computer system platform used to predict novel genes."
      Yu Z., Zheng Z., Tang T., Fu Y.
      Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Brain.
    7. "SCIMP, a transmembrane adapter protein involved in major histocompatibility complex class II signaling."
      Draber P., Vonkova I., Stepanek O., Hrdinka M., Kucova M., Skopcova T., Otahal P., Angelisova P., Horejsi V., Yeung M., Weiss A., Brdicka T.
      Mol. Cell. Biol. 31:4550-4562(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH BLNK; CD37; CD53; CD81; CSK AND LYN, PALMITOYLATION AT CYS-40 AND CYS-42, PHOSPHORYLATION, MUTAGENESIS OF TYR-69; TYR-107 AND TYR-131, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiSCIMP_HUMAN
    AccessioniPrimary (citable) accession number: Q6UWF3
    Secondary accession number(s): A6XGL4, B4DLK1, Q96MD0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 10, 2007
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 76 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3