Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6UW02

- CP20A_HUMAN

UniProt

Q6UW02 - CP20A_HUMAN

Protein

Cytochrome P450 20A1

Gene

CYP20A1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    RH + reduced flavoprotein + O2 = ROH + oxidized flavoprotein + H2O.

    Cofactori

    Heme group.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi409 – 4091Iron (heme axial ligand)By similarity

    GO - Molecular functioni

    1. heme binding Source: InterPro
    2. iron ion binding Source: InterPro
    3. monooxygenase activity Source: UniProtKB-KW
    4. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Source: InterPro

    Keywords - Molecular functioni

    Monooxygenase, Oxidoreductase

    Keywords - Ligandi

    Heme, Iron, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytochrome P450 20A1 (EC:1.14.-.-)
    Gene namesi
    Name:CYP20A1
    ORF Names:UNQ667/PRO1301
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:20576. CYP20A1.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. membrane Source: UniProtKB

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134911420.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 462462Cytochrome P450 20A1PRO_0000318095Add
    BLAST

    Proteomic databases

    MaxQBiQ6UW02.
    PaxDbiQ6UW02.
    PRIDEiQ6UW02.

    PTM databases

    PhosphoSiteiQ6UW02.

    Expressioni

    Gene expression databases

    ArrayExpressiQ6UW02.
    BgeeiQ6UW02.
    CleanExiHS_CYP20A1.
    GenevestigatoriQ6UW02.

    Organism-specific databases

    HPAiHPA055872.
    HPA058461.

    Interactioni

    Protein-protein interaction databases

    BioGridi121506. 1 interaction.
    STRINGi9606.ENSP00000348380.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6UW02.
    SMRiQ6UW02. Positions 31-461.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei4 – 2421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the cytochrome P450 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG2124.
    HOGENOMiHOG000111913.
    HOVERGENiHBG076231.
    InParanoidiQ6UW02.
    KOiK07435.
    OrthoDBiEOG7QC7VZ.
    PhylomeDBiQ6UW02.
    TreeFamiTF105089.

    Family and domain databases

    Gene3Di1.10.630.10. 1 hit.
    InterProiIPR001128. Cyt_P450.
    IPR002401. Cyt_P450_E_grp-I.
    [Graphical view]
    PfamiPF00067. p450. 1 hit.
    [Graphical view]
    PRINTSiPR00463. EP450I.
    SUPFAMiSSF48264. SSF48264. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6UW02-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLDFAIFAVT FLLALVGAVL YLYPASRQAA GIPGITPTEE KDGNLPDIVN    50
    SGSLHEFLVN LHERYGPVVS FWFGRRLVVS LGTVDVLKQH INPNKTSDPF 100
    ETMLKSLLRY QSGGGSVSEN HMRKKLYENG VTDSLKSNFA LLLKLSEELL 150
    DKWLSYPETQ HVPLSQHMLG FAMKSVTQMV MGSTFEDDQE VIRFQKNHGT 200
    VWSEIGKGFL DGSLDKNMTR KKQYEDALMQ LESVLRNIIK ERKGRNFSQH 250
    IFIDSLVQGN LNDQQILEDS MIFSLASCII TAKLCTWAIC FLTTSEEVQK 300
    KLYEEINQVF GNGPVTPEKI EQLRYCQHVL CETVRTAKLT PVSAQLQDIE 350
    GKIDRFIIPR ETLVLYALGV VLQDPNTWPS PHKFDPDRFD DELVMKTFSS 400
    LGFSGTQECP ELRFAYMVTT VLLSVLVKRL HLLSVEGQVI ETKYELVTSS 450
    REEAWITVSK RY 462
    Length:462
    Mass (Da):52,432
    Last modified:July 5, 2004 - v1
    Checksum:i4C0FEFFA0B9B055A
    GO
    Isoform 2 (identifier: Q6UW02-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         201-251: VWSEIGKGFLDGSLDKNMTRKKQYEDALMQLESVLRNIIKERKGRNFSQHI → PSCNWSLFKEHHKRTKRKELQSTY

    Show »
    Length:435
    Mass (Da):49,428
    Checksum:i3D3C3F46D0312978
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti77 – 771L → V in AAG09681. 1 PublicationCurated
    Sequence conflicti124 – 1241K → E in AAH20616. (PubMed:15489334)Curated
    Sequence conflicti333 – 3342TV → LF in AAG09681. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti97 – 971S → L.2 Publications
    Corresponds to variant rs2043449 [ dbSNP | Ensembl ].
    VAR_059153
    Natural varianti346 – 3461L → F.2 Publications
    Corresponds to variant rs1048013 [ dbSNP | Ensembl ].
    VAR_059154

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei201 – 25151VWSEI…FSQHI → PSCNWSLFKEHHKRTKRKEL QSTY in isoform 2. 1 PublicationVSP_055585Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF183412 mRNA. Translation: AAG09681.1.
    AY359068 mRNA. Translation: AAQ89427.1.
    AC011737 Genomic DNA. Translation: AAX88915.1.
    BC020616 mRNA. Translation: AAH20616.1.
    BC033752 mRNA. Translation: AAH33752.1.
    CCDSiCCDS2357.1.
    RefSeqiNP_803882.1. NM_177538.2.
    UniGeneiHs.446065.
    Hs.707756.

    Genome annotation databases

    EnsembliENST00000356079; ENSP00000348380; ENSG00000119004. [Q6UW02-1]
    GeneIDi57404.
    KEGGihsa:57404.
    UCSCiuc002uzv.4. human.

    Polymorphism databases

    DMDMi74749375.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF183412 mRNA. Translation: AAG09681.1 .
    AY359068 mRNA. Translation: AAQ89427.1 .
    AC011737 Genomic DNA. Translation: AAX88915.1 .
    BC020616 mRNA. Translation: AAH20616.1 .
    BC033752 mRNA. Translation: AAH33752.1 .
    CCDSi CCDS2357.1.
    RefSeqi NP_803882.1. NM_177538.2.
    UniGenei Hs.446065.
    Hs.707756.

    3D structure databases

    ProteinModelPortali Q6UW02.
    SMRi Q6UW02. Positions 31-461.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121506. 1 interaction.
    STRINGi 9606.ENSP00000348380.

    PTM databases

    PhosphoSitei Q6UW02.

    Polymorphism databases

    DMDMi 74749375.

    Proteomic databases

    MaxQBi Q6UW02.
    PaxDbi Q6UW02.
    PRIDEi Q6UW02.

    Protocols and materials databases

    DNASUi 57404.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000356079 ; ENSP00000348380 ; ENSG00000119004 . [Q6UW02-1 ]
    GeneIDi 57404.
    KEGGi hsa:57404.
    UCSCi uc002uzv.4. human.

    Organism-specific databases

    CTDi 57404.
    GeneCardsi GC02P204103.
    HGNCi HGNC:20576. CYP20A1.
    HPAi HPA055872.
    HPA058461.
    neXtProti NX_Q6UW02.
    PharmGKBi PA134911420.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2124.
    HOGENOMi HOG000111913.
    HOVERGENi HBG076231.
    InParanoidi Q6UW02.
    KOi K07435.
    OrthoDBi EOG7QC7VZ.
    PhylomeDBi Q6UW02.
    TreeFami TF105089.

    Miscellaneous databases

    ChiTaRSi CYP20A1. human.
    GeneWikii CYP20A1.
    GenomeRNAii 57404.
    NextBioi 63512.
    PROi Q6UW02.

    Gene expression databases

    ArrayExpressi Q6UW02.
    Bgeei Q6UW02.
    CleanExi HS_CYP20A1.
    Genevestigatori Q6UW02.

    Family and domain databases

    Gene3Di 1.10.630.10. 1 hit.
    InterProi IPR001128. Cyt_P450.
    IPR002401. Cyt_P450_E_grp-I.
    [Graphical view ]
    Pfami PF00067. p450. 1 hit.
    [Graphical view ]
    PRINTSi PR00463. EP450I.
    SUPFAMi SSF48264. SSF48264. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "A novel gene expressed in human pheochromocytoma."
      Peng Y., Li Y., Tu Y., Xu S., Han Z., Fu G., Chen Z.
      Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANTS LEU-97 AND PHE-346.
      Tissue: Pheochromocytoma.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS LEU-97 AND PHE-346.
      Tissue: Blood and Lung.

    Entry informationi

    Entry nameiCP20A_HUMAN
    AccessioniPrimary (citable) accession number: Q6UW02
    Secondary accession number(s): Q4ZG61
    , Q8N4Q8, Q8WWA9, Q9HC04
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 5, 2008
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 100 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3