Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome P450 20A1

Gene

CYP20A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

RH + reduced flavoprotein + O2 = ROH + oxidized flavoprotein + H2O.

Cofactori

hemeBy similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi409 – 4091Iron (heme axial ligand)By similarity

GO - Molecular functioni

  1. heme binding Source: InterPro
  2. iron ion binding Source: InterPro
  3. monooxygenase activity Source: UniProtKB-KW
  4. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Monooxygenase, Oxidoreductase

Keywords - Ligandi

Heme, Iron, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome P450 20A1 (EC:1.14.-.-)
Gene namesi
Name:CYP20A1
ORF Names:UNQ667/PRO1301
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:20576. CYP20A1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei4 – 2421HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134911420.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 462462Cytochrome P450 20A1PRO_0000318095Add
BLAST

Proteomic databases

MaxQBiQ6UW02.
PaxDbiQ6UW02.
PRIDEiQ6UW02.

PTM databases

PhosphoSiteiQ6UW02.

Expressioni

Gene expression databases

BgeeiQ6UW02.
CleanExiHS_CYP20A1.
ExpressionAtlasiQ6UW02. baseline and differential.
GenevestigatoriQ6UW02.

Organism-specific databases

HPAiHPA055872.
HPA058461.

Interactioni

Protein-protein interaction databases

BioGridi121506. 1 interaction.
STRINGi9606.ENSP00000348380.

Structurei

3D structure databases

ProteinModelPortaliQ6UW02.
SMRiQ6UW02. Positions 31-461.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG2124.
GeneTreeiENSGT00500000044939.
HOGENOMiHOG000111913.
HOVERGENiHBG076231.
InParanoidiQ6UW02.
KOiK07435.
OrthoDBiEOG7QC7VZ.
PhylomeDBiQ6UW02.
TreeFamiTF105089.

Family and domain databases

Gene3Di1.10.630.10. 1 hit.
InterProiIPR001128. Cyt_P450.
IPR002401. Cyt_P450_E_grp-I.
[Graphical view]
PfamiPF00067. p450. 1 hit.
[Graphical view]
PRINTSiPR00463. EP450I.
SUPFAMiSSF48264. SSF48264. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6UW02-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLDFAIFAVT FLLALVGAVL YLYPASRQAA GIPGITPTEE KDGNLPDIVN
60 70 80 90 100
SGSLHEFLVN LHERYGPVVS FWFGRRLVVS LGTVDVLKQH INPNKTSDPF
110 120 130 140 150
ETMLKSLLRY QSGGGSVSEN HMRKKLYENG VTDSLKSNFA LLLKLSEELL
160 170 180 190 200
DKWLSYPETQ HVPLSQHMLG FAMKSVTQMV MGSTFEDDQE VIRFQKNHGT
210 220 230 240 250
VWSEIGKGFL DGSLDKNMTR KKQYEDALMQ LESVLRNIIK ERKGRNFSQH
260 270 280 290 300
IFIDSLVQGN LNDQQILEDS MIFSLASCII TAKLCTWAIC FLTTSEEVQK
310 320 330 340 350
KLYEEINQVF GNGPVTPEKI EQLRYCQHVL CETVRTAKLT PVSAQLQDIE
360 370 380 390 400
GKIDRFIIPR ETLVLYALGV VLQDPNTWPS PHKFDPDRFD DELVMKTFSS
410 420 430 440 450
LGFSGTQECP ELRFAYMVTT VLLSVLVKRL HLLSVEGQVI ETKYELVTSS
460
REEAWITVSK RY
Length:462
Mass (Da):52,432
Last modified:July 5, 2004 - v1
Checksum:i4C0FEFFA0B9B055A
GO
Isoform 2 (identifier: Q6UW02-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     201-251: VWSEIGKGFLDGSLDKNMTRKKQYEDALMQLESVLRNIIKERKGRNFSQHI → PSCNWSLFKEHHKRTKRKELQSTY

Show »
Length:435
Mass (Da):49,428
Checksum:i3D3C3F46D0312978
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti77 – 771L → V in AAG09681 (Ref. 1) Curated
Sequence conflicti124 – 1241K → E in AAH20616 (PubMed:15489334).Curated
Sequence conflicti333 – 3342TV → LF in AAG09681 (Ref. 1) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti97 – 971S → L.2 Publications
Corresponds to variant rs2043449 [ dbSNP | Ensembl ].
VAR_059153
Natural varianti346 – 3461L → F.3 Publications
Corresponds to variant rs1048013 [ dbSNP | Ensembl ].
VAR_059154

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei201 – 25151VWSEI…FSQHI → PSCNWSLFKEHHKRTKRKEL QSTY in isoform 2. 1 PublicationVSP_055585Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF183412 mRNA. Translation: AAG09681.1.
AY359068 mRNA. Translation: AAQ89427.1.
AC011737 Genomic DNA. Translation: AAX88915.1.
BC020616 mRNA. Translation: AAH20616.1.
BC033752 mRNA. Translation: AAH33752.1.
CCDSiCCDS2357.1. [Q6UW02-1]
RefSeqiNP_803882.1. NM_177538.2. [Q6UW02-1]
UniGeneiHs.446065.
Hs.707756.

Genome annotation databases

EnsembliENST00000356079; ENSP00000348380; ENSG00000119004. [Q6UW02-1]
ENST00000611416; ENSP00000477866; ENSG00000119004. [Q6UW02-2]
GeneIDi57404.
KEGGihsa:57404.
UCSCiuc002uzv.4. human. [Q6UW02-1]

Polymorphism databases

DMDMi74749375.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF183412 mRNA. Translation: AAG09681.1.
AY359068 mRNA. Translation: AAQ89427.1.
AC011737 Genomic DNA. Translation: AAX88915.1.
BC020616 mRNA. Translation: AAH20616.1.
BC033752 mRNA. Translation: AAH33752.1.
CCDSiCCDS2357.1. [Q6UW02-1]
RefSeqiNP_803882.1. NM_177538.2. [Q6UW02-1]
UniGeneiHs.446065.
Hs.707756.

3D structure databases

ProteinModelPortaliQ6UW02.
SMRiQ6UW02. Positions 31-461.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121506. 1 interaction.
STRINGi9606.ENSP00000348380.

PTM databases

PhosphoSiteiQ6UW02.

Polymorphism databases

DMDMi74749375.

Proteomic databases

MaxQBiQ6UW02.
PaxDbiQ6UW02.
PRIDEiQ6UW02.

Protocols and materials databases

DNASUi57404.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356079; ENSP00000348380; ENSG00000119004. [Q6UW02-1]
ENST00000611416; ENSP00000477866; ENSG00000119004. [Q6UW02-2]
GeneIDi57404.
KEGGihsa:57404.
UCSCiuc002uzv.4. human. [Q6UW02-1]

Organism-specific databases

CTDi57404.
GeneCardsiGC02P204103.
HGNCiHGNC:20576. CYP20A1.
HPAiHPA055872.
HPA058461.
neXtProtiNX_Q6UW02.
PharmGKBiPA134911420.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG2124.
GeneTreeiENSGT00500000044939.
HOGENOMiHOG000111913.
HOVERGENiHBG076231.
InParanoidiQ6UW02.
KOiK07435.
OrthoDBiEOG7QC7VZ.
PhylomeDBiQ6UW02.
TreeFamiTF105089.

Miscellaneous databases

ChiTaRSiCYP20A1. human.
GeneWikiiCYP20A1.
GenomeRNAii57404.
NextBioi63512.
PROiQ6UW02.

Gene expression databases

BgeeiQ6UW02.
CleanExiHS_CYP20A1.
ExpressionAtlasiQ6UW02. baseline and differential.
GenevestigatoriQ6UW02.

Family and domain databases

Gene3Di1.10.630.10. 1 hit.
InterProiIPR001128. Cyt_P450.
IPR002401. Cyt_P450_E_grp-I.
[Graphical view]
PfamiPF00067. p450. 1 hit.
[Graphical view]
PRINTSiPR00463. EP450I.
SUPFAMiSSF48264. SSF48264. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A novel gene expressed in human pheochromocytoma."
    Peng Y., Li Y., Tu Y., Xu S., Han Z., Fu G., Chen Z.
    Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANTS LEU-97 AND PHE-346.
    Tissue: Pheochromocytoma.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS LEU-97 AND PHE-346.
    Tissue: Blood and Lung.
  5. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT [LARGE SCALE ANALYSIS] PHE-346, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiCP20A_HUMAN
AccessioniPrimary (citable) accession number: Q6UW02
Secondary accession number(s): Q4ZG61
, Q8N4Q8, Q8WWA9, Q9HC04
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: July 5, 2004
Last modified: March 4, 2015
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.