SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6UW02

- CP20A_HUMAN

UniProt

Q6UW02 - CP20A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cytochrome P450 20A1
Gene
CYP20A1, UNQ667/PRO1301
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Catalytic activityi

RH + reduced flavoprotein + O2 = ROH + oxidized flavoprotein + H2O.

Cofactori

Heme group By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi409 – 4091Iron (heme axial ligand) By similarity

GO - Molecular functioni

  1. heme binding Source: InterPro
  2. iron ion binding Source: InterPro
  3. monooxygenase activity Source: UniProtKB-KW
  4. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Monooxygenase, Oxidoreductase

Keywords - Ligandi

Heme, Iron, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome P450 20A1 (EC:1.14.-.-)
Gene namesi
Name:CYP20A1
ORF Names:UNQ667/PRO1301
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:20576. CYP20A1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei4 – 2421Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134911420.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 462462Cytochrome P450 20A1
PRO_0000318095Add
BLAST

Proteomic databases

MaxQBiQ6UW02.
PaxDbiQ6UW02.
PRIDEiQ6UW02.

PTM databases

PhosphoSiteiQ6UW02.

Expressioni

Gene expression databases

ArrayExpressiQ6UW02.
BgeeiQ6UW02.
CleanExiHS_CYP20A1.
GenevestigatoriQ6UW02.

Organism-specific databases

HPAiHPA055872.
HPA058461.

Interactioni

Protein-protein interaction databases

BioGridi121506. 1 interaction.
STRINGi9606.ENSP00000348380.

Structurei

3D structure databases

ProteinModelPortaliQ6UW02.
SMRiQ6UW02. Positions 31-461.

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG2124.
HOGENOMiHOG000111913.
HOVERGENiHBG076231.
InParanoidiQ6UW02.
KOiK07435.
OrthoDBiEOG7QC7VZ.
PhylomeDBiQ6UW02.
TreeFamiTF105089.

Family and domain databases

Gene3Di1.10.630.10. 1 hit.
InterProiIPR001128. Cyt_P450.
IPR002401. Cyt_P450_E_grp-I.
[Graphical view]
PfamiPF00067. p450. 1 hit.
[Graphical view]
PRINTSiPR00463. EP450I.
SUPFAMiSSF48264. SSF48264. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6UW02-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLDFAIFAVT FLLALVGAVL YLYPASRQAA GIPGITPTEE KDGNLPDIVN    50
SGSLHEFLVN LHERYGPVVS FWFGRRLVVS LGTVDVLKQH INPNKTSDPF 100
ETMLKSLLRY QSGGGSVSEN HMRKKLYENG VTDSLKSNFA LLLKLSEELL 150
DKWLSYPETQ HVPLSQHMLG FAMKSVTQMV MGSTFEDDQE VIRFQKNHGT 200
VWSEIGKGFL DGSLDKNMTR KKQYEDALMQ LESVLRNIIK ERKGRNFSQH 250
IFIDSLVQGN LNDQQILEDS MIFSLASCII TAKLCTWAIC FLTTSEEVQK 300
KLYEEINQVF GNGPVTPEKI EQLRYCQHVL CETVRTAKLT PVSAQLQDIE 350
GKIDRFIIPR ETLVLYALGV VLQDPNTWPS PHKFDPDRFD DELVMKTFSS 400
LGFSGTQECP ELRFAYMVTT VLLSVLVKRL HLLSVEGQVI ETKYELVTSS 450
REEAWITVSK RY 462
Length:462
Mass (Da):52,432
Last modified:July 5, 2004 - v1
Checksum:i4C0FEFFA0B9B055A
GO
Isoform 2 (identifier: Q6UW02-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     201-251: VWSEIGKGFLDGSLDKNMTRKKQYEDALMQLESVLRNIIKERKGRNFSQHI → PSCNWSLFKEHHKRTKRKELQSTY

Show »
Length:435
Mass (Da):49,428
Checksum:i3D3C3F46D0312978
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti97 – 971S → L.1 Publication
Corresponds to variant rs2043449 [ dbSNP | Ensembl ].
VAR_059153
Natural varianti346 – 3461L → F.1 Publication
Corresponds to variant rs1048013 [ dbSNP | Ensembl ].
VAR_059154

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei201 – 25151VWSEI…FSQHI → PSCNWSLFKEHHKRTKRKEL QSTY in isoform 2.
VSP_055585Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti77 – 771L → V in AAG09681. 1 Publication
Sequence conflicti124 – 1241K → E in AAH20616. 1 Publication
Sequence conflicti333 – 3342TV → LF in AAG09681. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF183412 mRNA. Translation: AAG09681.1.
AY359068 mRNA. Translation: AAQ89427.1.
AC011737 Genomic DNA. Translation: AAX88915.1.
BC020616 mRNA. Translation: AAH20616.1.
BC033752 mRNA. Translation: AAH33752.1.
CCDSiCCDS2357.1.
RefSeqiNP_803882.1. NM_177538.2.
UniGeneiHs.446065.
Hs.707756.

Genome annotation databases

EnsembliENST00000356079; ENSP00000348380; ENSG00000119004.
GeneIDi57404.
KEGGihsa:57404.
UCSCiuc002uzv.4. human.

Polymorphism databases

DMDMi74749375.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF183412 mRNA. Translation: AAG09681.1 .
AY359068 mRNA. Translation: AAQ89427.1 .
AC011737 Genomic DNA. Translation: AAX88915.1 .
BC020616 mRNA. Translation: AAH20616.1 .
BC033752 mRNA. Translation: AAH33752.1 .
CCDSi CCDS2357.1.
RefSeqi NP_803882.1. NM_177538.2.
UniGenei Hs.446065.
Hs.707756.

3D structure databases

ProteinModelPortali Q6UW02.
SMRi Q6UW02. Positions 31-461.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121506. 1 interaction.
STRINGi 9606.ENSP00000348380.

PTM databases

PhosphoSitei Q6UW02.

Polymorphism databases

DMDMi 74749375.

Proteomic databases

MaxQBi Q6UW02.
PaxDbi Q6UW02.
PRIDEi Q6UW02.

Protocols and materials databases

DNASUi 57404.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000356079 ; ENSP00000348380 ; ENSG00000119004 .
GeneIDi 57404.
KEGGi hsa:57404.
UCSCi uc002uzv.4. human.

Organism-specific databases

CTDi 57404.
GeneCardsi GC02P204103.
HGNCi HGNC:20576. CYP20A1.
HPAi HPA055872.
HPA058461.
neXtProti NX_Q6UW02.
PharmGKBi PA134911420.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2124.
HOGENOMi HOG000111913.
HOVERGENi HBG076231.
InParanoidi Q6UW02.
KOi K07435.
OrthoDBi EOG7QC7VZ.
PhylomeDBi Q6UW02.
TreeFami TF105089.

Miscellaneous databases

ChiTaRSi CYP20A1. human.
GeneWikii CYP20A1.
GenomeRNAii 57404.
NextBioi 63512.
PROi Q6UW02.

Gene expression databases

ArrayExpressi Q6UW02.
Bgeei Q6UW02.
CleanExi HS_CYP20A1.
Genevestigatori Q6UW02.

Family and domain databases

Gene3Di 1.10.630.10. 1 hit.
InterProi IPR001128. Cyt_P450.
IPR002401. Cyt_P450_E_grp-I.
[Graphical view ]
Pfami PF00067. p450. 1 hit.
[Graphical view ]
PRINTSi PR00463. EP450I.
SUPFAMi SSF48264. SSF48264. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel gene expressed in human pheochromocytoma."
    Peng Y., Li Y., Tu Y., Xu S., Han Z., Fu G., Chen Z.
    Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANTS LEU-97 AND PHE-346.
    Tissue: Pheochromocytoma.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS LEU-97 AND PHE-346.
    Tissue: Blood and Lung.

Entry informationi

Entry nameiCP20A_HUMAN
AccessioniPrimary (citable) accession number: Q6UW02
Secondary accession number(s): Q4ZG61
, Q8N4Q8, Q8WWA9, Q9HC04
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: July 5, 2004
Last modified: September 3, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi