Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6UVW9

- CLC2A_HUMAN

UniProt

Q6UVW9 - CLC2A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

C-type lectin domain family 2 member A

Gene

CLEC2A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Plays a role in modulating the extent of T-cell expansion. Enhances the expansion of TCR-stimulated T-cells by increasing their survival through enhanced expression of anti-apoptotic proteins. May modulate the capacity of T-cells to home to lymph nodes through SELL. Facilitates dedicated immune recognition of keratinocytes via interaction with its receptor KLRF2 by stimulating natural killer cell mediated cytotoxicity.2 Publications

GO - Molecular functioni

  1. carbohydrate binding Source: UniProtKB-KW
  2. protein homodimerization activity Source: UniProtKB

GO - Biological processi

  1. natural killer cell mediated cytotoxicity Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

Lectin

Protein family/group databases

MEROPSiI63.001.

Names & Taxonomyi

Protein namesi
Recommended name:
C-type lectin domain family 2 member A
Alternative name(s):
Keratinocyte-associated C-type lectin
Short name:
KACL
Proliferation-induced lymphocyte-associated receptor
Short name:
PILAR
Gene namesi
Name:CLEC2A
Synonyms:KACL
ORF Names:UNQ5792/PRO19597
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:24191. CLEC2A.

Subcellular locationi

Cell membrane 2 Publications; Single-pass type II membrane protein 2 Publications

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi148 – 1481F → A: Reduces affinity for KLRF2 40-fold. 1 Publication
Mutagenesisi152 – 1521D → A: No effect on affinity for KLRF2. 1 Publication
Mutagenesisi155 – 1551H → A: Slightly reduces affinity for KLRF2. 1 Publication
Mutagenesisi157 – 1582SR → AA: Reduces affinity for KLRF2 over 10'000-fold. 1 Publication
Mutagenesisi160 – 1612FI → AA: Reduces affinity for KLRF2 550-fold.
Mutagenesisi162 – 1621D → A: Reduces affinity for KLRF2 360-fold. 1 Publication

Organism-specific databases

PharmGKBiPA142672099.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 174174C-type lectin domain family 2 member APRO_0000264240Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi58 ↔ 691 PublicationPROSITE-ProRule annotation
Glycosylationi78 – 781N-linked (GlcNAc...)1 Publication
Disulfide bondi86 ↔ 1671 PublicationPROSITE-ProRule annotation
Glycosylationi130 – 1301N-linked (GlcNAc...)1 Publication
Glycosylationi143 – 1431N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

N-glycosylated.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ6UVW9.
PRIDEiQ6UVW9.

Expressioni

Tissue specificityi

Mainly expressed in skin. Also expressed in keratinocytes, spleen, thymus, small intestine, peripheral blood monocytes, bone marrow, ovary, testis and skin. High expression in CD8+, B-lymphocytes and naive CD4+ T-cells. Restricted mostly to proliferating lymphocytes. Not detected in myeloid leukocytes or natural killer (NK) cells.3 Publications

Inductioni

By phytohemagglutinin (PHA) in peripheral CD8+ T cells.

Gene expression databases

CleanExiHS_CLEC2A.
GenevestigatoriQ6UVW9.

Organism-specific databases

HPAiHPA048530.

Interactioni

Subunit structurei

Homodimer; non disulfide-linked. Interacts with KLRB1. Interacts with KLRF2.3 Publications

Protein-protein interaction databases

DIPiDIP-58611N.
STRINGi9606.ENSP00000396163.

Structurei

Secondary structure

1
174
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi60 – 656
Beta strandi68 – 725
Helixi79 – 879
Turni88 – 903
Helixi99 – 1079
Turni108 – 1114
Beta strandi114 – 1218
Beta strandi129 – 1313
Beta strandi143 – 1497
Beta strandi154 – 1574
Beta strandi163 – 1708

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4IOPX-ray3.20A46-174[»]
ProteinModelPortaliQ6UVW9.
SMRiQ6UVW9. Positions 56-172.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2727CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini49 – 174126ExtracellularSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei28 – 4821Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini65 – 174110C-type lectinPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 C-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG259216.
GeneTreeiENSGT00710000106527.
HOGENOMiHOG000059595.
HOVERGENiHBG107718.
InParanoidiQ6UVW9.
OMAiEAWISFI.
OrthoDBiEOG7R833G.
PhylomeDBiQ6UVW9.
TreeFamiTF351467.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR016187. C-type_lectin_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6UVW9-1) [UniParc]FASTAAdd to Basket

Also known as: CLEC2A1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MINPELRDGR ADGFIHRIVP KLIQNWKIGL MCFLSIIITT VCIIMIATWS
60 70 80 90 100
KHAKPVACSG DWLGVRDKCF YFSDDTRNWT ASKIFCSLQK AELAQIDTQE
110 120 130 140 150
DMEFLKRYAG TDMHWIGLSR KQGDSWKWTN GTTFNGWFEI IGNGSFAFLS
160 170
ADGVHSSRGF IDIKWICSKP KYFL
Length:174
Mass (Da):19,972
Last modified:November 4, 2008 - v2
Checksum:i76E137A5053361B9
GO
Isoform 2 (identifier: Q6UVW9-2) [UniParc]FASTAAdd to Basket

Also known as: CLEC2A2

The sequence of this isoform differs from the canonical sequence as follows:
     138-174: FEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL → PSNSKWSCNWSLRQWLLLLGPLR

Show »
Length:160
Mass (Da):18,576
Checksum:i6689FAF3B31AE2DE
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti136 – 1361G → D.1 Publication
Corresponds to variant rs526680 [ dbSNP | Ensembl ].
VAR_029629

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei138 – 17437FEIIG…PKYFL → PSNSKWSCNWSLRQWLLLLG PLR in isoform 2. 2 PublicationsVSP_035643Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
EF127467 mRNA. Translation: ABO33172.1.
AY359126 mRNA. Translation: AAQ89483.1.
EU095393 mRNA. Translation: ABW79912.1.
EU095394 mRNA. Translation: ABW79913.1.
CCDSiCCDS44829.1. [Q6UVW9-1]
CCDS8606.1. [Q6UVW9-2]
RefSeqiNP_001124183.1. NM_001130711.1. [Q6UVW9-1]
NP_997258.1. NM_207375.2.
UniGeneiHs.527665.

Genome annotation databases

EnsembliENST00000339766; ENSP00000339732; ENSG00000188393. [Q6UVW9-2]
ENST00000455827; ENSP00000396163; ENSG00000188393. [Q6UVW9-1]
GeneIDi387836.
KEGGihsa:387836.
UCSCiuc009zhb.2. human. [Q6UVW9-2]
uc009zhc.2. human. [Q6UVW9-1]

Polymorphism databases

DMDMi212276429.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
EF127467 mRNA. Translation: ABO33172.1 .
AY359126 mRNA. Translation: AAQ89483.1 .
EU095393 mRNA. Translation: ABW79912.1 .
EU095394 mRNA. Translation: ABW79913.1 .
CCDSi CCDS44829.1. [Q6UVW9-1 ]
CCDS8606.1. [Q6UVW9-2 ]
RefSeqi NP_001124183.1. NM_001130711.1. [Q6UVW9-1 ]
NP_997258.1. NM_207375.2.
UniGenei Hs.527665.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4IOP X-ray 3.20 A 46-174 [» ]
ProteinModelPortali Q6UVW9.
SMRi Q6UVW9. Positions 56-172.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-58611N.
STRINGi 9606.ENSP00000396163.

Protein family/group databases

MEROPSi I63.001.

Polymorphism databases

DMDMi 212276429.

Proteomic databases

PaxDbi Q6UVW9.
PRIDEi Q6UVW9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000339766 ; ENSP00000339732 ; ENSG00000188393 . [Q6UVW9-2 ]
ENST00000455827 ; ENSP00000396163 ; ENSG00000188393 . [Q6UVW9-1 ]
GeneIDi 387836.
KEGGi hsa:387836.
UCSCi uc009zhb.2. human. [Q6UVW9-2 ]
uc009zhc.2. human. [Q6UVW9-1 ]

Organism-specific databases

CTDi 387836.
GeneCardsi GC12M010051.
H-InvDB HIX0036770.
HGNCi HGNC:24191. CLEC2A.
HPAi HPA048530.
MIMi 612087. gene.
neXtProti NX_Q6UVW9.
PharmGKBi PA142672099.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG259216.
GeneTreei ENSGT00710000106527.
HOGENOMi HOG000059595.
HOVERGENi HBG107718.
InParanoidi Q6UVW9.
OMAi EAWISFI.
OrthoDBi EOG7R833G.
PhylomeDBi Q6UVW9.
TreeFami TF351467.

Miscellaneous databases

GenomeRNAii 387836.
NextBioi 101654.
PROi Q6UVW9.
SOURCEi Search...

Gene expression databases

CleanExi HS_CLEC2A.
Genevestigatori Q6UVW9.

Family and domain databases

Gene3Di 3.10.100.10. 1 hit.
InterProi IPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR016187. C-type_lectin_fold.
[Graphical view ]
Pfami PF00059. Lectin_C. 1 hit.
[Graphical view ]
SMARTi SM00034. CLECT. 1 hit.
[Graphical view ]
SUPFAMi SSF56436. SSF56436. 1 hit.
PROSITEi PS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH KLRB1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Spleen.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "CLEC2A: a novel, alternatively spliced and skin-associated member of the NKC-encoded AICL-CD69-LLT1 family."
    Spreu J., Kienle E.C., Schrage B., Steinle A.
    Immunogenetics 59:903-912(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8-166 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 8-154 (ISOFORM 2), VARIANT ASP-136, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Histiocytic lymphoma.
  4. "Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes."
    Spreu J., Kuttruff S., Stejfova V., Dennehy K.M., Schittek B., Steinle A.
    Proc. Natl. Acad. Sci. U.S.A. 107:5100-5105(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBUNIT, GLYCOSYLATION, TISSUE SPECIFICITY.
  5. "Structure of NKp65 bound to its keratinocyte ligand reveals basis for genetically linked recognition in natural killer gene complex."
    Li Y., Wang Q., Chen S., Brown P.H., Mariuzza R.A.
    Proc. Natl. Acad. Sci. U.S.A. 110:11505-11510(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS) OF 46-174 IN COMPLEX WITH KLRF2, SUBUNIT, INTERACTION WITH KLRF2, MUTAGENESIS OF PHE-148; ASP-152; HIS-155; 157-SER-ARG-158 AND ASP-162, GLYCOSYLATION AT ASN-78 AND ASN-130, DISULFIDE BOND.

Entry informationi

Entry nameiCLC2A_HUMAN
AccessioniPrimary (citable) accession number: Q6UVW9
Secondary accession number(s): A5Y4G5, A9QKS2, A9QKS3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: November 4, 2008
Last modified: October 29, 2014
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3