Q6UVW9 (CLC2A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: C-type lectin domain family 2 member A Alternative name(s): Keratinocyte-associated C-type lectin Short name=KACL Proliferation-induced lymphocyte-associated receptor Short name=PILAR | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 174 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in modulating the extent of T-cell expansion. Enhances the expansion of TCR-stimulated T-cells by increasing their survival through enhanced expression of anti-apoptotic proteins. May modulate the capacity of T-cells to home to lymph nodes through SELL. Facilitates dedicated immune recognition of keratinocytes via interaction with its receptor KLRF2 by stimulating natural killer cell mediated cytotoxicity. Ref.1 Ref.4 |
| Subunit structure | Homodimer; non disulfide-linked. Interacts with KLRB1. Interacts with KLRF2. Ref.1 Ref.4 |
| Subcellular location | Cell membrane; Single-pass type II membrane protein Ref.1 Ref.3. |
| Tissue specificity | Mainly expressed in skin. Also expressed in keratinocytes, spleen, thymus, small intestine, peripheral blood monocytes, bone marrow, ovary, testis and skin. High expression in CD8+, B-lymphocytes and naive CD4+ T-cells. Restricted mostly to proliferating lymphocytes. Not detected in myeloid leukocytes or natural killer (NK) cells. Ref.1 Ref.3 Ref.4 |
| Induction | By phytohemagglutinin (PHA) in peripheral CD8+ T cells. |
| Post-translational modification | N-glycosylated. Ref.4 |
| Sequence similarities | Contains 1 C-type lectin domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Ligand | Lectin |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | natural killer cell mediated cytotoxicity Traceable author statement Ref.4. Source: UniProtKB |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | carbohydrate binding Inferred from electronic annotation. Source: InterPro protein homodimerization activityInferred from direct assay Ref.4. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6UVW9-1) Also known as: CLEC2A1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6UVW9-2) Also known as: CLEC2A2; The sequence of this isoform differs from the canonical sequence as follows: 138-174: FEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL → PSNSKWSCNWSLRQWLLLLGPLR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 174 | 174 | C-type lectin domain family 2 member A | PRO_0000264240 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 27 | 27 | Cytoplasmic Potential | ||||||||
| Transmembrane | 28 – 48 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 49 – 174 | 126 | Extracellular Potential | ||||||||
| Domain | 65 – 174 | 110 | C-type lectin | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 78 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 130 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 143 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 58 ↔ 69 | By similarity | |||||||||
| Disulfide bond | 86 ↔ 167 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 138 – 174 | 37 | FEIIG…PKYFL → PSNSKWSCNWSLRQWLLLLG PLR in isoform 2. | VSP_035643 | |||||||
| Natural variant | 136 | 1 | G → D. Ref.3 Corresponds to variant rs526680 [ dbSNP | Ensembl ]. | VAR_029629 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PILAR is a novel modulator of human T-cell expansion." Huarte E., Cubillos-Ruiz J.R., Nesbeth Y.C., Scarlett U.K., Martinez D.G., Engle X.A., Rigby W.F., Pioli P.A., Guyre P.M., Conejo-Garcia J.R. Blood 112:1259-1268(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH KLRB1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Spleen. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "CLEC2A: a novel, alternatively spliced and skin-associated member of the NKC-encoded AICL-CD69-LLT1 family." Spreu J., Kienle E.C., Schrage B., Steinle A. Immunogenetics 59:903-912(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8-166 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 8-154 (ISOFORM 2), VARIANT ASP-136, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Histiocytic lymphoma. |
| [4] | "Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes." Spreu J., Kuttruff S., Stejfova V., Dennehy K.M., Schittek B., Steinle A. Proc. Natl. Acad. Sci. U.S.A. 107:5100-5105(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT, GLYCOSYLATION, TISSUE SPECIFICITY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | EF127467 mRNA. Translation: ABO33172.1. AY359126 mRNA. Translation: AAQ89483.1. EU095393 mRNA. Translation: ABW79912.1. EU095394 mRNA. Translation: ABW79913.1. |
| IPI | IPI00398946. IPI00914678. |
| RefSeq | NP_001124183.1. NM_001130711.1. |
| UniGene | Hs.527665. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1FM5 based on UniProtKB Q07108. |
| ProteinModelPortal | Q6UVW9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-58611N. |
| STRING | 9606.ENSP00000396163. |
Polymorphism databases | |
| DMDM | 212276429. |
Proteomic databases | |
| PaxDb | Q6UVW9. |
| PRIDE | Q6UVW9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000339766; ENSP00000339732; ENSG00000188393. ENST00000455827; ENSP00000396163; ENSG00000188393. |
| GeneID | 387836. |
| KEGG | hsa:387836. |
| UCSC | uc009zhb.2. human. uc009zhc.2. human. |
Organism-specific databases | |
| CTD | 387836. |
| GeneCards | GC12M010051. |
| H-InvDB | HIX0036770. |
| HGNC | HGNC:24191. CLEC2A. |
| HPA | HPA048530. |
| MIM | 612087. gene. |
| neXtProt | NX_Q6UVW9. |
| PharmGKB | PA142672099. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG259216. |
| HOGENOM | HOG000059595. |
| HOVERGEN | HBG107718. |
| OMA | DIKWICS. |
Gene expression databases | |
| CleanEx | HS_CLEC2A. |
| Genevestigator | Q6UVW9. |
Family and domain databases | |
| Gene3D | 3.10.100.10. 1 hit. |
| InterPro | IPR001304. C-type_lectin. IPR016186. C-type_lectin-like. IPR016187. C-type_lectin_fold. [Graphical view] |
| Pfam | PF00059. Lectin_C. 1 hit. [Graphical view] |
| SMART | SM00034. CLECT. 1 hit. [Graphical view] |
| SUPFAM | SSF56436. C-type_lectin_fold. 1 hit. |
| PROSITE | PS00615. C_TYPE_LECTIN_1. False negative. PS50041. C_TYPE_LECTIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 387836. |
| NextBio | 101654. |
| SOURCE | Search... |
Entry information
| Entry name | CLC2A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6UVW9 Secondary accession number(s): A5Y4G5, A9QKS2, A9QKS3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
