Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-type lectin domain family 2 member A

Gene

CLEC2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in modulating the extent of T-cell expansion. Enhances the expansion of TCR-stimulated T-cells by increasing their survival through enhanced expression of anti-apoptotic proteins. May modulate the capacity of T-cells to home to lymph nodes through SELL. Facilitates dedicated immune recognition of keratinocytes via interaction with its receptor KLRF2 by stimulating natural killer cell mediated cytotoxicity.2 Publications

GO - Molecular functioni

  • carbohydrate binding Source: UniProtKB-KW
  • protein homodimerization activity Source: UniProtKB

GO - Biological processi

  • natural killer cell mediated cytotoxicity Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

Lectin

Enzyme and pathway databases

BioCyciZFISH:G66-33189-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
C-type lectin domain family 2 member A
Alternative name(s):
Keratinocyte-associated C-type lectin
Short name:
KACL
Proliferation-induced lymphocyte-associated receptor
Short name:
PILAR
Gene namesi
Name:CLEC2A
Synonyms:KACL
ORF Names:UNQ5792/PRO19597
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:24191. CLEC2A.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 27CytoplasmicSequence analysisAdd BLAST27
Transmembranei28 – 48Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini49 – 174ExtracellularSequence analysisAdd BLAST126

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi148F → A: Reduces affinity for KLRF2 40-fold. 1 Publication1
Mutagenesisi152D → A: No effect on affinity for KLRF2. 1 Publication1
Mutagenesisi155H → A: Slightly reduces affinity for KLRF2. 1 Publication1
Mutagenesisi157 – 158SR → AA: Reduces affinity for KLRF2 over 10'000-fold. 1 Publication2
Mutagenesisi160 – 161FI → AA: Reduces affinity for KLRF2 550-fold. 2
Mutagenesisi162D → A: Reduces affinity for KLRF2 360-fold. 1 Publication1

Organism-specific databases

DisGeNETi387836.
OpenTargetsiENSG00000188393.
PharmGKBiPA142672099.

Polymorphism and mutation databases

BioMutaiCLEC2A.
DMDMi212276429.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002642401 – 174C-type lectin domain family 2 member AAdd BLAST174

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi58 ↔ 69PROSITE-ProRule annotation1 Publication
Glycosylationi78N-linked (GlcNAc...)1 Publication1
Disulfide bondi86 ↔ 167PROSITE-ProRule annotation1 Publication
Glycosylationi130N-linked (GlcNAc...)1 Publication1
Glycosylationi143N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

N-glycosylated.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ6UVW9.
PRIDEiQ6UVW9.
TopDownProteomicsiQ6UVW9-1. [Q6UVW9-1]

Expressioni

Tissue specificityi

Mainly expressed in skin. Also expressed in keratinocytes, spleen, thymus, small intestine, peripheral blood monocytes, bone marrow, ovary, testis and skin. High expression in CD8+, B-lymphocytes and naive CD4+ T-cells. Restricted mostly to proliferating lymphocytes. Not detected in myeloid leukocytes or natural killer (NK) cells.3 Publications

Inductioni

By phytohemagglutinin (PHA) in peripheral CD8+ T cells.

Gene expression databases

CleanExiHS_CLEC2A.

Organism-specific databases

HPAiHPA048530.

Interactioni

Subunit structurei

Homodimer; non disulfide-linked. Interacts with KLRB1. Interacts with KLRF2.3 Publications

GO - Molecular functioni

  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

DIPiDIP-58611N.
STRINGi9606.ENSP00000396163.

Structurei

Secondary structure

1174
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi60 – 65Combined sources6
Beta strandi68 – 72Combined sources5
Helixi79 – 87Combined sources9
Turni88 – 90Combined sources3
Helixi99 – 107Combined sources9
Turni108 – 111Combined sources4
Beta strandi114 – 121Combined sources8
Beta strandi129 – 131Combined sources3
Beta strandi143 – 149Combined sources7
Beta strandi154 – 157Combined sources4
Beta strandi163 – 170Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4IOPX-ray3.20A46-174[»]
ProteinModelPortaliQ6UVW9.
SMRiQ6UVW9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini65 – 174C-type lectinPROSITE-ProRule annotationAdd BLAST110

Sequence similaritiesi

Contains 1 C-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4297. Eukaryota.
ENOG410XPJ1. LUCA.
GeneTreeiENSGT00710000106527.
HOGENOMiHOG000059595.
HOVERGENiHBG107718.
InParanoidiQ6UVW9.
OMAiDIKWICS.
OrthoDBiEOG091G0J0L.
PhylomeDBiQ6UVW9.
TreeFamiTF351467.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR016187. CTDL_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6UVW9-1) [UniParc]FASTAAdd to basket
Also known as: CLEC2A1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MINPELRDGR ADGFIHRIVP KLIQNWKIGL MCFLSIIITT VCIIMIATWS
60 70 80 90 100
KHAKPVACSG DWLGVRDKCF YFSDDTRNWT ASKIFCSLQK AELAQIDTQE
110 120 130 140 150
DMEFLKRYAG TDMHWIGLSR KQGDSWKWTN GTTFNGWFEI IGNGSFAFLS
160 170
ADGVHSSRGF IDIKWICSKP KYFL
Length:174
Mass (Da):19,972
Last modified:November 4, 2008 - v2
Checksum:i76E137A5053361B9
GO
Isoform 2 (identifier: Q6UVW9-2) [UniParc]FASTAAdd to basket
Also known as: CLEC2A2

The sequence of this isoform differs from the canonical sequence as follows:
     138-174: FEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL → PSNSKWSCNWSLRQWLLLLGPLR

Show »
Length:160
Mass (Da):18,576
Checksum:i6689FAF3B31AE2DE
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_029629136G → D.1 PublicationCorresponds to variant rs526680dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_035643138 – 174FEIIG…PKYFL → PSNSKWSCNWSLRQWLLLLG PLR in isoform 2. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EF127467 mRNA. Translation: ABO33172.1.
AY359126 mRNA. Translation: AAQ89483.1.
EU095393 mRNA. Translation: ABW79912.1.
EU095394 mRNA. Translation: ABW79913.1.
CCDSiCCDS44829.1. [Q6UVW9-1]
CCDS8606.1. [Q6UVW9-2]
RefSeqiNP_001124183.1. NM_001130711.1. [Q6UVW9-1]
NP_997258.1. NM_207375.2. [Q6UVW9-2]
UniGeneiHs.527665.

Genome annotation databases

EnsembliENST00000339766; ENSP00000339732; ENSG00000188393. [Q6UVW9-2]
ENST00000455827; ENSP00000396163; ENSG00000188393. [Q6UVW9-1]
GeneIDi387836.
KEGGihsa:387836.
UCSCiuc009zhb.3. human. [Q6UVW9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EF127467 mRNA. Translation: ABO33172.1.
AY359126 mRNA. Translation: AAQ89483.1.
EU095393 mRNA. Translation: ABW79912.1.
EU095394 mRNA. Translation: ABW79913.1.
CCDSiCCDS44829.1. [Q6UVW9-1]
CCDS8606.1. [Q6UVW9-2]
RefSeqiNP_001124183.1. NM_001130711.1. [Q6UVW9-1]
NP_997258.1. NM_207375.2. [Q6UVW9-2]
UniGeneiHs.527665.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4IOPX-ray3.20A46-174[»]
ProteinModelPortaliQ6UVW9.
SMRiQ6UVW9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-58611N.
STRINGi9606.ENSP00000396163.

Polymorphism and mutation databases

BioMutaiCLEC2A.
DMDMi212276429.

Proteomic databases

PaxDbiQ6UVW9.
PRIDEiQ6UVW9.
TopDownProteomicsiQ6UVW9-1. [Q6UVW9-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339766; ENSP00000339732; ENSG00000188393. [Q6UVW9-2]
ENST00000455827; ENSP00000396163; ENSG00000188393. [Q6UVW9-1]
GeneIDi387836.
KEGGihsa:387836.
UCSCiuc009zhb.3. human. [Q6UVW9-1]

Organism-specific databases

CTDi387836.
DisGeNETi387836.
GeneCardsiCLEC2A.
H-InvDBHIX0036770.
HGNCiHGNC:24191. CLEC2A.
HPAiHPA048530.
MIMi612087. gene.
neXtProtiNX_Q6UVW9.
OpenTargetsiENSG00000188393.
PharmGKBiPA142672099.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4297. Eukaryota.
ENOG410XPJ1. LUCA.
GeneTreeiENSGT00710000106527.
HOGENOMiHOG000059595.
HOVERGENiHBG107718.
InParanoidiQ6UVW9.
OMAiDIKWICS.
OrthoDBiEOG091G0J0L.
PhylomeDBiQ6UVW9.
TreeFamiTF351467.

Enzyme and pathway databases

BioCyciZFISH:G66-33189-MONOMER.

Miscellaneous databases

GenomeRNAii387836.
PROiQ6UVW9.
SOURCEiSearch...

Gene expression databases

CleanExiHS_CLEC2A.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR016187. CTDL_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCLC2A_HUMAN
AccessioniPrimary (citable) accession number: Q6UVW9
Secondary accession number(s): A5Y4G5, A9QKS2, A9QKS3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: November 4, 2008
Last modified: November 30, 2016
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.