Q6UE05 (WBS28_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 53.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Williams-Beuren syndrome chromosomal region 28 protein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 265 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence caution | The sequence AAQ74836.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6UE05-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6UE05-2) The sequence of this isoform differs from the canonical sequence as follows: 25-60: LVQNRDHLYNFLLLKINLFNHWVSGLAQEARGSCNW → RQGLALSPSLERSGAGSARCSLQLPVSSNPPPSASK 61-265: Missing. | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 265 | 265 | Williams-Beuren syndrome chromosomal region 28 protein | PRO_0000308415 | |||||
Regions | |||||||||
| Transmembrane | 72 – 92 | 21 | Helical; Potential | ||||||
| Transmembrane | 130 – 150 | 21 | Helical; Potential | ||||||
| Transmembrane | 185 – 205 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 25 – 60 | 36 | LVQNR…GSCNW → RQGLALSPSLERSGAGSARC SLQLPVSSNPPPSASK in isoform 2. | VSP_039997 | |||||
| Alternative sequence | 61 – 265 | 205 | Missing in isoform 2. | VSP_039998 | |||||
| Natural variant | 14 | 1 | I → N. Ref.1 Ref.3 Corresponds to variant rs11770052 [ dbSNP | Ensembl ]. | VAR_036813 | |||||
| Natural variant | 67 | 1 | G → V. Corresponds to variant rs56933025 [ dbSNP | Ensembl ]. | VAR_061720 | |||||
| Natural variant | 70 | 1 | A → D. Ref.3 Corresponds to variant rs17852792 [ dbSNP | Ensembl ]. | VAR_036814 | |||||
| Natural variant | 78 | 1 | W → R. Ref.1 Ref.3 Corresponds to variant rs13227841 [ dbSNP | Ensembl ]. | VAR_036815 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Williams-Beuren syndrome TRIM50 encodes an E3 ubiquitin ligase." Micale L., Fusco C., Augello B., Napolitano L.M.R., Dermitzakis E.T., Meroni G., Merla G., Reymond A. Eur. J. Hum. Genet. 16:1038-1049(2008) [PubMed: 18398435] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 14-265 (ISOFORM 2), VARIANTS ASN-14 AND ARG-78. |
| [2] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ASN-14; ASP-70 AND ARG-78. Tissue: Testis. |
| [4] | Arakawa T., Carninci P., Fukuda S., Hasegawa A., Hayashida K., Hori F., Kai C., Kawai J., Kojima M., Murata M., Nakamura M., Nishiyori H., Nomura K., Ohno M., Sasaki D., Shibazaki E., Tagami M., Tagami Y., Hayashizaki Y. Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY372053 mRNA. Translation: AAQ74835.1. AY372054 mRNA. Translation: AAQ74836.1. Sequence problems. AC093168 Genomic DNA. No translation available. BC030643 mRNA. Translation: AAH30643.1. DB455624 mRNA. No translation available. |
| IPI | IPI00169282. IPI00868838. |
| RefSeq | NP_872310.2. NM_182504.3. |
| UniGene | Hs.647026. |
3D structure databases | |
| ProteinModelPortal | Q6UE05. |
| ModBase | Search... |
Polymorphism databases | |
| DMDM | 160221324. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000320531; ENSP00000316775; ENSG00000175877. |
| GeneID | 135886. |
| KEGG | hsa:135886. |
| NMPDR | fig|9606.3.peg.28778. |
| UCSC | uc003tzk.2. human. uc003tzl.2. human. |
Organism-specific databases | |
| CTD | 135886. |
| GeneCards | GC07P073275. |
| HGNC | HGNC:23018. WBSCR28. |
| MIM | 612547. gene. |
| neXtProt | NX_Q6UE05. |
| PharmGKB | PA145147726. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG14411. |
| GeneTree | ENSGT00390000009243. |
| HOVERGEN | HBG097748. |
| InParanoid | Q6UE05. |
| OMA | RLYWWVE. |
| OrthoDB | EOG4BG8X7. |
| PhylomeDB | Q6UE05. |
Gene expression databases | |
| ArrayExpress | Q6UE05. |
| Bgee | Q6UE05. |
| CleanEx | HS_WBSCR28. |
| Genevestigator | Q6UE05. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 83502. |
| SOURCE | Search... |
Entry information
| Entry name | WBS28_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6UE05 Secondary accession number(s): Q6UE04, Q8NHP4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with