SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6TCH7

- PAQR3_HUMAN

UniProt

Q6TCH7 - PAQR3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Progestin and adipoQ receptor family member 3

Gene
PAQR3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Functions as a spatial regulator of RAF1 kinase by sequestrating it to the Golgi.1 Publication

GO - Molecular functioni

  1. receptor activity Source: RefGenome

GO - Biological processi

  1. negative regulation of MAP kinase activity Source: MGI
  2. negative regulation of neuron projection development Source: MGI
  3. negative regulation of peptidyl-serine phosphorylation Source: MGI
  4. negative regulation of protein phosphorylation Source: MGI
  5. protein localization to Golgi apparatus Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Progestin and adipoQ receptor family member 3
Alternative name(s):
Progestin and adipoQ receptor family member III
Raf kinase trapping to Golgi
Short name:
RKTG
Gene namesi
Name:PAQR3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:30130. PAQR3.

Subcellular locationi

Golgi apparatus membrane; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 7373Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei74 – 9623Helical; Reviewed predictionAdd
BLAST
Topological domaini97 – 1059Lumenal Reviewed prediction
Transmembranei106 – 12823Helical; Reviewed predictionAdd
BLAST
Topological domaini129 – 14012Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei141 – 16323Helical; Reviewed predictionAdd
BLAST
Topological domaini164 – 1729Lumenal Reviewed prediction
Transmembranei173 – 19523Helical; Reviewed predictionAdd
BLAST
Topological domaini196 – 2016Cytoplasmic Reviewed prediction
Transmembranei202 – 22423Helical; Reviewed predictionAdd
BLAST
Topological domaini225 – 23814Lumenal Reviewed predictionAdd
BLAST
Transmembranei239 – 25618Helical; Reviewed predictionAdd
BLAST
Topological domaini257 – 27519Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei276 – 29823Helical; Reviewed predictionAdd
BLAST
Topological domaini299 – 31113Lumenal Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. Golgi apparatus Source: MGI
  2. Golgi membrane Source: UniProtKB-SubCell
  3. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134952039.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 311311Progestin and adipoQ receptor family member 3PRO_0000218846Add
BLAST

Proteomic databases

MaxQBiQ6TCH7.
PRIDEiQ6TCH7.

PTM databases

PhosphoSiteiQ6TCH7.

Expressioni

Tissue specificityi

Widely expressed in a range of tissues.1 Publication

Gene expression databases

ArrayExpressiQ6TCH7.
BgeeiQ6TCH7.
CleanExiHS_PAQR3.
GenevestigatoriQ6TCH7.

Organism-specific databases

HPAiHPA058453.

Interactioni

Protein-protein interaction databases

BioGridi127451. 1 interaction.
DIPiDIP-46464N.

Structurei

3D structure databases

ProteinModelPortaliQ6TCH7.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni61 – 7111Golgi targetingAdd
BLAST
Regioni299 – 3035Golgi targeting

Sequence similaritiesi

Belongs to the ADIPOR family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1272.
HOGENOMiHOG000007783.
HOVERGENiHBG053504.
InParanoidiQ6TCH7.
OMAiGGYQYWP.
OrthoDBiEOG7HF1J9.
PhylomeDBiQ6TCH7.
TreeFamiTF313640.

Family and domain databases

InterProiIPR004254. HlyIII-related.
[Graphical view]
PANTHERiPTHR20855. PTHR20855. 1 hit.
PfamiPF03006. HlyIII. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6TCH7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MHQKLLKSAH YIELGSYQYW PVLVPRGIRL YTYEQIPGSL KDNPYITDGY    50
RAYLPSRLCI KSLFILSNET VNIWSHLLGF FLFFTLGIYD MTSVLPSASA 100
SREDFVICSI CLFCFQVCML CSVGYHLFSC HRSEKTCRRW MALDYAGISI 150
GILGCYVSGV FYAFYCNNYW RQVYLITVLA MILAVFFAQI HPNYLTQQWQ 200
RLRSIIFCSV SGYGVIPTLH WVWLNGGIGA PIVQDFAPRV IVMYMIALLA 250
FLFYISKVPE RYFPGQLNYL GSSHQIWHIL AVVMLYWWHQ STVYVMQYRH 300
SKPCPDYVSH L 311
Length:311
Mass (Da):36,217
Last modified:August 31, 2004 - v2
Checksum:i8C629920D0F8D785
GO
Isoform 2 (identifier: Q6TCH7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-311: GQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL → ENIFRWEITKRTLGGVNNSLQNLYLLV

Note: No experimental confirmation available.

Show »
Length:291
Mass (Da):33,735
Checksum:iA11C6CD458D86096
GO
Isoform 3 (identifier: Q6TCH7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-311: GQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL → ESLPR

Note: No experimental confirmation available.

Show »
Length:269
Mass (Da):31,144
Checksum:i55B9A69DBEED4F92
GO
Isoform 4 (identifier: Q6TCH7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-88: SLFILSNETVNIWSHLLGFFLFFTLGI → RSVCFALWAIIFFPAIGQKKHVEDGWH
     89-311: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:88
Mass (Da):10,357
Checksum:iC7733512C770502E
GO

Sequence cautioni

The sequence BAG51571.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei62 – 8827SLFIL…FTLGI → RSVCFALWAIIFFPAIGQKK HVEDGWH in isoform 4. VSP_011477Add
BLAST
Alternative sequencei89 – 311223Missing in isoform 4. VSP_011478Add
BLAST
Alternative sequencei265 – 31147GQLNY…YVSHL → ENIFRWEITKRTLGGVNNSL QNLYLLV in isoform 2. VSP_011479Add
BLAST
Alternative sequencei265 – 31147GQLNY…YVSHL → ESLPR in isoform 3. VSP_011480Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti30 – 301L → Q in BAF83921. 1 Publication
Sequence conflicti258 – 2581V → A in AAR08369. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY424281 mRNA. Translation: AAR08369.1.
AK055774 mRNA. Translation: BAG51571.1. Different initiation.
AK291232 mRNA. Translation: BAF83921.1.
BC029604 mRNA. No translation available.
BC031256 mRNA. Translation: AAH31256.1.
BC047510 mRNA. Translation: AAH47510.1.
CCDSiCCDS34020.1. [Q6TCH7-1]
RefSeqiNP_001035292.1. NM_001040202.1. [Q6TCH7-1]
XP_005262827.1. XM_005262770.2. [Q6TCH7-3]
XP_006714167.1. XM_006714104.1. [Q6TCH7-1]
UniGeneiHs.657312.

Genome annotation databases

EnsembliENST00000295462; ENSP00000295462; ENSG00000163291. [Q6TCH7-4]
ENST00000395594; ENSP00000378959; ENSG00000163291. [Q6TCH7-3]
ENST00000511594; ENSP00000425080; ENSG00000163291. [Q6TCH7-1]
ENST00000512733; ENSP00000421981; ENSG00000163291. [Q6TCH7-1]
ENST00000512760; ENSP00000426875; ENSG00000163291. [Q6TCH7-4]
ENST00000515853; ENSP00000422357; ENSG00000163291. [Q6TCH7-4]
GeneIDi152559.
KEGGihsa:152559.
UCSCiuc003hlp.1. human. [Q6TCH7-1]

Polymorphism databases

DMDMi51701774.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY424281 mRNA. Translation: AAR08369.1 .
AK055774 mRNA. Translation: BAG51571.1 . Different initiation.
AK291232 mRNA. Translation: BAF83921.1 .
BC029604 mRNA. No translation available.
BC031256 mRNA. Translation: AAH31256.1 .
BC047510 mRNA. Translation: AAH47510.1 .
CCDSi CCDS34020.1. [Q6TCH7-1 ]
RefSeqi NP_001035292.1. NM_001040202.1. [Q6TCH7-1 ]
XP_005262827.1. XM_005262770.2. [Q6TCH7-3 ]
XP_006714167.1. XM_006714104.1. [Q6TCH7-1 ]
UniGenei Hs.657312.

3D structure databases

ProteinModelPortali Q6TCH7.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127451. 1 interaction.
DIPi DIP-46464N.

PTM databases

PhosphoSitei Q6TCH7.

Polymorphism databases

DMDMi 51701774.

Proteomic databases

MaxQBi Q6TCH7.
PRIDEi Q6TCH7.

Protocols and materials databases

DNASUi 152559.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000295462 ; ENSP00000295462 ; ENSG00000163291 . [Q6TCH7-4 ]
ENST00000395594 ; ENSP00000378959 ; ENSG00000163291 . [Q6TCH7-3 ]
ENST00000511594 ; ENSP00000425080 ; ENSG00000163291 . [Q6TCH7-1 ]
ENST00000512733 ; ENSP00000421981 ; ENSG00000163291 . [Q6TCH7-1 ]
ENST00000512760 ; ENSP00000426875 ; ENSG00000163291 . [Q6TCH7-4 ]
ENST00000515853 ; ENSP00000422357 ; ENSG00000163291 . [Q6TCH7-4 ]
GeneIDi 152559.
KEGGi hsa:152559.
UCSCi uc003hlp.1. human. [Q6TCH7-1 ]

Organism-specific databases

CTDi 152559.
GeneCardsi GC04M079808.
H-InvDB HIX0004326.
HGNCi HGNC:30130. PAQR3.
HPAi HPA058453.
MIMi 614577. gene.
neXtProti NX_Q6TCH7.
PharmGKBi PA134952039.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1272.
HOGENOMi HOG000007783.
HOVERGENi HBG053504.
InParanoidi Q6TCH7.
OMAi GGYQYWP.
OrthoDBi EOG7HF1J9.
PhylomeDBi Q6TCH7.
TreeFami TF313640.

Miscellaneous databases

ChiTaRSi PAQR3. human.
GenomeRNAii 152559.
NextBioi 86976.
PROi Q6TCH7.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q6TCH7.
Bgeei Q6TCH7.
CleanExi HS_PAQR3.
Genevestigatori Q6TCH7.

Family and domain databases

InterProi IPR004254. HlyIII-related.
[Graphical view ]
PANTHERi PTHR20855. PTHR20855. 1 hit.
Pfami PF03006. HlyIII. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif."
    Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J.M., Emtage P.C., Funk W.D.
    J. Mol. Evol. 61:372-380(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney and Teratocarcinoma.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
    Tissue: Testis.
  4. "Characterization of the topology and functional domains of RKTG."
    Luo X., Feng L., Jiang X., Xiao F., Wang Z., Feng G.S., Chen Y.
    Biochem. J. 414:399-406(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY.

Entry informationi

Entry nameiPAQR3_HUMAN
AccessioniPrimary (citable) accession number: Q6TCH7
Secondary accession number(s): A8K5B7
, B3KP59, Q6PIQ1, Q86X05, Q8NCP9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: July 9, 2014
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi