Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6TCH7

- PAQR3_HUMAN

UniProt

Q6TCH7 - PAQR3_HUMAN

Protein

Progestin and adipoQ receptor family member 3

Gene

PAQR3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 92 (01 Oct 2014)
      Sequence version 2 (31 Aug 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a spatial regulator of RAF1 kinase by sequestrating it to the Golgi.1 Publication

    GO - Molecular functioni

    1. receptor activity Source: RefGenome

    GO - Biological processi

    1. negative regulation of MAP kinase activity Source: MGI
    2. negative regulation of neuron projection development Source: MGI
    3. negative regulation of peptidyl-serine phosphorylation Source: MGI
    4. negative regulation of protein phosphorylation Source: MGI
    5. protein localization to Golgi apparatus Source: MGI

    Keywords - Molecular functioni

    Receptor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Progestin and adipoQ receptor family member 3
    Alternative name(s):
    Progestin and adipoQ receptor family member III
    Raf kinase trapping to Golgi
    Short name:
    RKTG
    Gene namesi
    Name:PAQR3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:30130. PAQR3.

    Subcellular locationi

    Golgi apparatus membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. Golgi apparatus Source: MGI
    2. Golgi membrane Source: UniProtKB-SubCell
    3. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134952039.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 311311Progestin and adipoQ receptor family member 3PRO_0000218846Add
    BLAST

    Proteomic databases

    MaxQBiQ6TCH7.
    PRIDEiQ6TCH7.

    PTM databases

    PhosphoSiteiQ6TCH7.

    Expressioni

    Tissue specificityi

    Widely expressed in a range of tissues.1 Publication

    Gene expression databases

    ArrayExpressiQ6TCH7.
    BgeeiQ6TCH7.
    CleanExiHS_PAQR3.
    GenevestigatoriQ6TCH7.

    Organism-specific databases

    HPAiHPA058453.

    Interactioni

    Protein-protein interaction databases

    BioGridi127451. 1 interaction.
    DIPiDIP-46464N.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6TCH7.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 7373CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini97 – 1059LumenalSequence Analysis
    Topological domaini129 – 14012CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini164 – 1729LumenalSequence Analysis
    Topological domaini196 – 2016CytoplasmicSequence Analysis
    Topological domaini225 – 23814LumenalSequence AnalysisAdd
    BLAST
    Topological domaini257 – 27519CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini299 – 31113LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei74 – 9623HelicalSequence AnalysisAdd
    BLAST
    Transmembranei106 – 12823HelicalSequence AnalysisAdd
    BLAST
    Transmembranei141 – 16323HelicalSequence AnalysisAdd
    BLAST
    Transmembranei173 – 19523HelicalSequence AnalysisAdd
    BLAST
    Transmembranei202 – 22423HelicalSequence AnalysisAdd
    BLAST
    Transmembranei239 – 25618HelicalSequence AnalysisAdd
    BLAST
    Transmembranei276 – 29823HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni61 – 7111Golgi targetingAdd
    BLAST
    Regioni299 – 3035Golgi targeting

    Sequence similaritiesi

    Belongs to the ADIPOR family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1272.
    HOGENOMiHOG000007783.
    HOVERGENiHBG053504.
    InParanoidiQ6TCH7.
    OMAiGGYQYWP.
    OrthoDBiEOG7HF1J9.
    PhylomeDBiQ6TCH7.
    TreeFamiTF313640.

    Family and domain databases

    InterProiIPR004254. HlyIII-related.
    [Graphical view]
    PANTHERiPTHR20855. PTHR20855. 1 hit.
    PfamiPF03006. HlyIII. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6TCH7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MHQKLLKSAH YIELGSYQYW PVLVPRGIRL YTYEQIPGSL KDNPYITDGY    50
    RAYLPSRLCI KSLFILSNET VNIWSHLLGF FLFFTLGIYD MTSVLPSASA 100
    SREDFVICSI CLFCFQVCML CSVGYHLFSC HRSEKTCRRW MALDYAGISI 150
    GILGCYVSGV FYAFYCNNYW RQVYLITVLA MILAVFFAQI HPNYLTQQWQ 200
    RLRSIIFCSV SGYGVIPTLH WVWLNGGIGA PIVQDFAPRV IVMYMIALLA 250
    FLFYISKVPE RYFPGQLNYL GSSHQIWHIL AVVMLYWWHQ STVYVMQYRH 300
    SKPCPDYVSH L 311
    Length:311
    Mass (Da):36,217
    Last modified:August 31, 2004 - v2
    Checksum:i8C629920D0F8D785
    GO
    Isoform 2 (identifier: Q6TCH7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         265-311: GQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL → ENIFRWEITKRTLGGVNNSLQNLYLLV

    Note: No experimental confirmation available.

    Show »
    Length:291
    Mass (Da):33,735
    Checksum:iA11C6CD458D86096
    GO
    Isoform 3 (identifier: Q6TCH7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         265-311: GQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL → ESLPR

    Note: No experimental confirmation available.

    Show »
    Length:269
    Mass (Da):31,144
    Checksum:i55B9A69DBEED4F92
    GO
    Isoform 4 (identifier: Q6TCH7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         62-88: SLFILSNETVNIWSHLLGFFLFFTLGI → RSVCFALWAIIFFPAIGQKKHVEDGWH
         89-311: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:88
    Mass (Da):10,357
    Checksum:iC7733512C770502E
    GO

    Sequence cautioni

    The sequence BAG51571.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti30 – 301L → Q in BAF83921. (PubMed:14702039)Curated
    Sequence conflicti258 – 2581V → A in AAR08369. (PubMed:16044242)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei62 – 8827SLFIL…FTLGI → RSVCFALWAIIFFPAIGQKK HVEDGWH in isoform 4. 1 PublicationVSP_011477Add
    BLAST
    Alternative sequencei89 – 311223Missing in isoform 4. 1 PublicationVSP_011478Add
    BLAST
    Alternative sequencei265 – 31147GQLNY…YVSHL → ENIFRWEITKRTLGGVNNSL QNLYLLV in isoform 2. 1 PublicationVSP_011479Add
    BLAST
    Alternative sequencei265 – 31147GQLNY…YVSHL → ESLPR in isoform 3. 1 PublicationVSP_011480Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY424281 mRNA. Translation: AAR08369.1.
    AK055774 mRNA. Translation: BAG51571.1. Different initiation.
    AK291232 mRNA. Translation: BAF83921.1.
    BC029604 mRNA. No translation available.
    BC031256 mRNA. Translation: AAH31256.1.
    BC047510 mRNA. Translation: AAH47510.1.
    CCDSiCCDS34020.1. [Q6TCH7-1]
    RefSeqiNP_001035292.1. NM_001040202.1. [Q6TCH7-1]
    XP_005262827.1. XM_005262770.2. [Q6TCH7-3]
    XP_006714167.1. XM_006714104.1. [Q6TCH7-1]
    UniGeneiHs.657312.

    Genome annotation databases

    EnsembliENST00000395594; ENSP00000378959; ENSG00000163291. [Q6TCH7-3]
    ENST00000511594; ENSP00000425080; ENSG00000163291. [Q6TCH7-1]
    ENST00000512733; ENSP00000421981; ENSG00000163291. [Q6TCH7-1]
    ENST00000512760; ENSP00000426875; ENSG00000163291. [Q6TCH7-4]
    ENST00000515853; ENSP00000422357; ENSG00000163291. [Q6TCH7-4]
    GeneIDi152559.
    KEGGihsa:152559.
    UCSCiuc003hlp.1. human. [Q6TCH7-1]

    Polymorphism databases

    DMDMi51701774.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY424281 mRNA. Translation: AAR08369.1 .
    AK055774 mRNA. Translation: BAG51571.1 . Different initiation.
    AK291232 mRNA. Translation: BAF83921.1 .
    BC029604 mRNA. No translation available.
    BC031256 mRNA. Translation: AAH31256.1 .
    BC047510 mRNA. Translation: AAH47510.1 .
    CCDSi CCDS34020.1. [Q6TCH7-1 ]
    RefSeqi NP_001035292.1. NM_001040202.1. [Q6TCH7-1 ]
    XP_005262827.1. XM_005262770.2. [Q6TCH7-3 ]
    XP_006714167.1. XM_006714104.1. [Q6TCH7-1 ]
    UniGenei Hs.657312.

    3D structure databases

    ProteinModelPortali Q6TCH7.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127451. 1 interaction.
    DIPi DIP-46464N.

    PTM databases

    PhosphoSitei Q6TCH7.

    Polymorphism databases

    DMDMi 51701774.

    Proteomic databases

    MaxQBi Q6TCH7.
    PRIDEi Q6TCH7.

    Protocols and materials databases

    DNASUi 152559.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000395594 ; ENSP00000378959 ; ENSG00000163291 . [Q6TCH7-3 ]
    ENST00000511594 ; ENSP00000425080 ; ENSG00000163291 . [Q6TCH7-1 ]
    ENST00000512733 ; ENSP00000421981 ; ENSG00000163291 . [Q6TCH7-1 ]
    ENST00000512760 ; ENSP00000426875 ; ENSG00000163291 . [Q6TCH7-4 ]
    ENST00000515853 ; ENSP00000422357 ; ENSG00000163291 . [Q6TCH7-4 ]
    GeneIDi 152559.
    KEGGi hsa:152559.
    UCSCi uc003hlp.1. human. [Q6TCH7-1 ]

    Organism-specific databases

    CTDi 152559.
    GeneCardsi GC04M079808.
    H-InvDB HIX0004326.
    HGNCi HGNC:30130. PAQR3.
    HPAi HPA058453.
    MIMi 614577. gene.
    neXtProti NX_Q6TCH7.
    PharmGKBi PA134952039.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1272.
    HOGENOMi HOG000007783.
    HOVERGENi HBG053504.
    InParanoidi Q6TCH7.
    OMAi GGYQYWP.
    OrthoDBi EOG7HF1J9.
    PhylomeDBi Q6TCH7.
    TreeFami TF313640.

    Miscellaneous databases

    ChiTaRSi PAQR3. human.
    GenomeRNAii 152559.
    NextBioi 86976.
    PROi Q6TCH7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6TCH7.
    Bgeei Q6TCH7.
    CleanExi HS_PAQR3.
    Genevestigatori Q6TCH7.

    Family and domain databases

    InterProi IPR004254. HlyIII-related.
    [Graphical view ]
    PANTHERi PTHR20855. PTHR20855. 1 hit.
    Pfami PF03006. HlyIII. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif."
      Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J.M., Emtage P.C., Funk W.D.
      J. Mol. Evol. 61:372-380(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Kidney and Teratocarcinoma.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
      Tissue: Testis.
    4. "Characterization of the topology and functional domains of RKTG."
      Luo X., Feng L., Jiang X., Xiao F., Wang Z., Feng G.S., Chen Y.
      Biochem. J. 414:399-406(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY.

    Entry informationi

    Entry nameiPAQR3_HUMAN
    AccessioniPrimary (citable) accession number: Q6TCH7
    Secondary accession number(s): A8K5B7
    , B3KP59, Q6PIQ1, Q86X05, Q8NCP9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 31, 2004
    Last sequence update: August 31, 2004
    Last modified: October 1, 2014
    This is version 92 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3