Q6TCH7 (PAQR3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Progestin and adipoQ receptor family member 3 Alternative name(s): Progestin and adipoQ receptor family member III Raf kinase trapping to Golgi Short name=RKTG | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 311 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a spatial regulator of RAF1 kinase by sequestrating it to the Golgi. Ref.4 |
| Subcellular location | Golgi apparatus membrane; Multi-pass membrane protein Ref.4. |
| Tissue specificity | Widely expressed in a range of tissues. Ref.1 |
| Sequence similarities | Belongs to the ADIPOR family. |
| Sequence caution | The sequence BAG51571.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | Golgi membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6TCH7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6TCH7-2) The sequence of this isoform differs from the canonical sequence as follows: 265-311: GQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL → ENIFRWEITKRTLGGVNNSLQNLYLLV | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q6TCH7-3) The sequence of this isoform differs from the canonical sequence as follows: 265-311: GQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL → ESLPR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q6TCH7-4) The sequence of this isoform differs from the canonical sequence as follows: 62-88: SLFILSNETVNIWSHLLGFFLFFTLGI → RSVCFALWAIIFFPAIGQKKHVEDGWH 89-311: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 311 | 311 | Progestin and adipoQ receptor family member 3 | PRO_0000218846 | |||||
Regions | |||||||||
| Topological domain | 1 – 73 | 73 | Cytoplasmic Potential | ||||||
| Transmembrane | 74 – 96 | 23 | Helical; Potential | ||||||
| Topological domain | 97 – 105 | 9 | Lumenal Potential | ||||||
| Transmembrane | 106 – 128 | 23 | Helical; Potential | ||||||
| Topological domain | 129 – 140 | 12 | Cytoplasmic Potential | ||||||
| Transmembrane | 141 – 163 | 23 | Helical; Potential | ||||||
| Topological domain | 164 – 172 | 9 | Lumenal Potential | ||||||
| Transmembrane | 173 – 195 | 23 | Helical; Potential | ||||||
| Topological domain | 196 – 201 | 6 | Cytoplasmic Potential | ||||||
| Transmembrane | 202 – 224 | 23 | Helical; Potential | ||||||
| Topological domain | 225 – 238 | 14 | Lumenal Potential | ||||||
| Transmembrane | 239 – 256 | 18 | Helical; Potential | ||||||
| Topological domain | 257 – 275 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 276 – 298 | 23 | Helical; Potential | ||||||
| Topological domain | 299 – 311 | 13 | Lumenal Potential | ||||||
| Region | 61 – 71 | 11 | Golgi targeting | ||||||
| Region | 299 – 303 | 5 | Golgi targeting | ||||||
Natural variations | |||||||||
| Alternative sequence | 62 – 88 | 27 | SLFIL…FTLGI → RSVCFALWAIIFFPAIGQKK HVEDGWH in isoform 4. | VSP_011477 | |||||
| Alternative sequence | 89 – 311 | 223 | Missing in isoform 4. | VSP_011478 | |||||
| Alternative sequence | 265 – 311 | 47 | GQLNY…YVSHL → ENIFRWEITKRTLGGVNNSL QNLYLLV in isoform 2. | VSP_011479 | |||||
| Alternative sequence | 265 – 311 | 47 | GQLNY…YVSHL → ESLPR in isoform 3. | VSP_011480 | |||||
Experimental info | |||||||||
| Sequence conflict | 30 | 1 | L → Q in BAF83921. Ref.2 | ||||||
| Sequence conflict | 258 | 1 | V → A in AAR08369. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif." Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J.M., Emtage P.C., Funk W.D. J. Mol. Evol. 61:372-380(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney and Teratocarcinoma. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4). Tissue: Testis. |
| [4] | "Characterization of the topology and functional domains of RKTG." Luo X., Feng L., Jiang X., Xiao F., Wang Z., Feng G.S., Chen Y. Biochem. J. 414:399-406(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY424281 mRNA. Translation: AAR08369.1. AK055774 mRNA. Translation: BAG51571.1. Different initiation. AK291232 mRNA. Translation: BAF83921.1. BC029604 mRNA. No translation available. BC031256 mRNA. Translation: AAH31256.1. BC047510 mRNA. Translation: AAH47510.1. |
| IPI | IPI00301648. IPI00329109. IPI00457115. IPI00457116. |
| RefSeq | NP_001035292.1. NM_001040202.1. |
| UniGene | Hs.657312. |
3D structure databases | |
| ProteinModelPortal | Q6TCH7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-46464N. |
PTM databases | |
| PhosphoSite | Q6TCH7. |
Polymorphism databases | |
| DMDM | 51701774. |
Proteomic databases | |
| PRIDE | Q6TCH7. |
Protocols and materials databases | |
| DNASU | 152559. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000295462; ENSP00000295462; ENSG00000163291. ENST00000395594; ENSP00000378959; ENSG00000163291. ENST00000511594; ENSP00000425080; ENSG00000163291. ENST00000512733; ENSP00000421981; ENSG00000163291. ENST00000512760; ENSP00000426875; ENSG00000163291. ENST00000515853; ENSP00000422357; ENSG00000163291. |
| GeneID | 152559. |
| KEGG | hsa:152559. |
| UCSC | uc003hlp.1. human. |
Organism-specific databases | |
| CTD | 152559. |
| GeneCards | GC04M079808. |
| H-InvDB | HIX0004326. |
| HGNC | HGNC:30130. PAQR3. |
| MIM | 614577. gene. |
| neXtProt | NX_Q6TCH7. |
| PharmGKB | PA134952039. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1272. |
| HOGENOM | HOG000007783. |
| HOVERGEN | HBG053504. |
| InParanoid | Q6TCH7. |
| OMA | PTIHWVW. |
Gene expression databases | |
| ArrayExpress | Q6TCH7. |
| Bgee | Q6TCH7. |
| CleanEx | HS_PAQR3. |
| Genevestigator | Q6TCH7. |
| GermOnline | ENSG00000163291. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004254. HlyIII-related. [Graphical view] |
| PANTHER | PTHR20855. PTHR20855. 1 hit. |
| Pfam | PF03006. HlyIII. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PAQR3. human. |
| GenomeRNAi | 152559. |
| NextBio | 86976. |
| SOURCE | Search... |
Entry information
| Entry name | PAQR3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6TCH7 Secondary accession number(s): A8K5B7 Q8NCP9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
