Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6TCH7 (PAQR3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 91. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Progestin and adipoQ receptor family member 3
Alternative name(s):
Progestin and adipoQ receptor family member III
Raf kinase trapping to Golgi
Short name=RKTG
Gene names
Name:PAQR3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length311 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Functions as a spatial regulator of RAF1 kinase by sequestrating it to the Golgi. Ref.4

Subcellular location

Golgi apparatus membrane; Multi-pass membrane protein Ref.4.

Tissue specificity

Widely expressed in a range of tissues. Ref.1

Sequence similarities

Belongs to the ADIPOR family.

Sequence caution

The sequence BAG51571.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6TCH7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6TCH7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     265-311: GQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL → ENIFRWEITKRTLGGVNNSLQNLYLLV
Note: No experimental confirmation available.
Isoform 3 (identifier: Q6TCH7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     265-311: GQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL → ESLPR
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6TCH7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     62-88: SLFILSNETVNIWSHLLGFFLFFTLGI → RSVCFALWAIIFFPAIGQKKHVEDGWH
     89-311: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 311311Progestin and adipoQ receptor family member 3
PRO_0000218846

Regions

Topological domain1 – 7373Cytoplasmic Potential
Transmembrane74 – 9623Helical; Potential
Topological domain97 – 1059Lumenal Potential
Transmembrane106 – 12823Helical; Potential
Topological domain129 – 14012Cytoplasmic Potential
Transmembrane141 – 16323Helical; Potential
Topological domain164 – 1729Lumenal Potential
Transmembrane173 – 19523Helical; Potential
Topological domain196 – 2016Cytoplasmic Potential
Transmembrane202 – 22423Helical; Potential
Topological domain225 – 23814Lumenal Potential
Transmembrane239 – 25618Helical; Potential
Topological domain257 – 27519Cytoplasmic Potential
Transmembrane276 – 29823Helical; Potential
Topological domain299 – 31113Lumenal Potential
Region61 – 7111Golgi targeting
Region299 – 3035Golgi targeting

Natural variations

Alternative sequence62 – 8827SLFIL…FTLGI → RSVCFALWAIIFFPAIGQKK HVEDGWH in isoform 4.
VSP_011477
Alternative sequence89 – 311223Missing in isoform 4.
VSP_011478
Alternative sequence265 – 31147GQLNY…YVSHL → ENIFRWEITKRTLGGVNNSL QNLYLLV in isoform 2.
VSP_011479
Alternative sequence265 – 31147GQLNY…YVSHL → ESLPR in isoform 3.
VSP_011480

Experimental info

Sequence conflict301L → Q in BAF83921. Ref.2
Sequence conflict2581V → A in AAR08369. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified August 31, 2004. Version 2.
Checksum: 8C629920D0F8D785

FASTA31136,217
        10         20         30         40         50         60 
MHQKLLKSAH YIELGSYQYW PVLVPRGIRL YTYEQIPGSL KDNPYITDGY RAYLPSRLCI 

        70         80         90        100        110        120 
KSLFILSNET VNIWSHLLGF FLFFTLGIYD MTSVLPSASA SREDFVICSI CLFCFQVCML 

       130        140        150        160        170        180 
CSVGYHLFSC HRSEKTCRRW MALDYAGISI GILGCYVSGV FYAFYCNNYW RQVYLITVLA 

       190        200        210        220        230        240 
MILAVFFAQI HPNYLTQQWQ RLRSIIFCSV SGYGVIPTLH WVWLNGGIGA PIVQDFAPRV 

       250        260        270        280        290        300 
IVMYMIALLA FLFYISKVPE RYFPGQLNYL GSSHQIWHIL AVVMLYWWHQ STVYVMQYRH 

       310 
SKPCPDYVSH L 

« Hide

Isoform 2 [UniParc].

Checksum: A11C6CD458D86096
Show »

FASTA29133,735
Isoform 3 [UniParc].

Checksum: 55B9A69DBEED4F92
Show »

FASTA26931,144
Isoform 4 [UniParc].

Checksum: C7733512C770502E
Show »

FASTA8810,357

References

« Hide 'large scale' references
[1]"PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif."
Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J.M., Emtage P.C., Funk W.D.
J. Mol. Evol. 61:372-380(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Kidney and Teratocarcinoma.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
Tissue: Testis.
[4]"Characterization of the topology and functional domains of RKTG."
Luo X., Feng L., Jiang X., Xiao F., Wang Z., Feng G.S., Chen Y.
Biochem. J. 414:399-406(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY424281 mRNA. Translation: AAR08369.1.
AK055774 mRNA. Translation: BAG51571.1. Different initiation.
AK291232 mRNA. Translation: BAF83921.1.
BC029604 mRNA. No translation available.
BC031256 mRNA. Translation: AAH31256.1.
BC047510 mRNA. Translation: AAH47510.1.
CCDSCCDS34020.1. [Q6TCH7-1]
RefSeqNP_001035292.1. NM_001040202.1. [Q6TCH7-1]
XP_005262827.1. XM_005262770.2. [Q6TCH7-3]
XP_006714167.1. XM_006714104.1. [Q6TCH7-1]
UniGeneHs.657312.

3D structure databases

ProteinModelPortalQ6TCH7.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127451. 1 interaction.
DIPDIP-46464N.

PTM databases

PhosphoSiteQ6TCH7.

Polymorphism databases

DMDM51701774.

Proteomic databases

MaxQBQ6TCH7.
PRIDEQ6TCH7.

Protocols and materials databases

DNASU152559.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000295462; ENSP00000295462; ENSG00000163291. [Q6TCH7-4]
ENST00000395594; ENSP00000378959; ENSG00000163291. [Q6TCH7-3]
ENST00000511594; ENSP00000425080; ENSG00000163291. [Q6TCH7-1]
ENST00000512733; ENSP00000421981; ENSG00000163291. [Q6TCH7-1]
ENST00000512760; ENSP00000426875; ENSG00000163291. [Q6TCH7-4]
ENST00000515853; ENSP00000422357; ENSG00000163291. [Q6TCH7-4]
GeneID152559.
KEGGhsa:152559.
UCSCuc003hlp.1. human. [Q6TCH7-1]

Organism-specific databases

CTD152559.
GeneCardsGC04M079808.
H-InvDBHIX0004326.
HGNCHGNC:30130. PAQR3.
HPAHPA058453.
MIM614577. gene.
neXtProtNX_Q6TCH7.
PharmGKBPA134952039.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1272.
HOGENOMHOG000007783.
HOVERGENHBG053504.
InParanoidQ6TCH7.
OMAGGYQYWP.
OrthoDBEOG7HF1J9.
PhylomeDBQ6TCH7.
TreeFamTF313640.

Gene expression databases

ArrayExpressQ6TCH7.
BgeeQ6TCH7.
CleanExHS_PAQR3.
GenevestigatorQ6TCH7.

Family and domain databases

InterProIPR004254. HlyIII-related.
[Graphical view]
PANTHERPTHR20855. PTHR20855. 1 hit.
PfamPF03006. HlyIII. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPAQR3. human.
GenomeRNAi152559.
NextBio86976.
PROQ6TCH7.
SOURCESearch...

Entry information

Entry namePAQR3_HUMAN
AccessionPrimary (citable) accession number: Q6TCH7
Secondary accession number(s): A8K5B7 expand/collapse secondary AC list , B3KP59, Q6PIQ1, Q86X05, Q8NCP9
Entry history
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: July 9, 2014
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM