Q6S5L8 (SHC4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SHC-transforming protein 4 Alternative name(s): Rai-like protein Short name=RaLP SHC-transforming protein D Short name=hShcD Src homology 2 domain-containing-transforming protein C4 Short name=SH2 domain protein C4 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 630 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Activates both Ras-dependent and Ras-independent migratory pathways in melanomas. Contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1. Ref.1 |
| Subunit structure | Interacts (via PID domain) with phosphorylated MUSK (via NPXY motif); undergoes tyrosine phosphorylation downstream of activated MUSK. Interacts with GRB2; the interaction is dependent of Tyr-424 phosphorylation and increased by EGF. Ref.4 |
| Subcellular location | Cell junction › synapse › postsynaptic cell membrane. Note: Colocalized with MUSK at the neuromuscular junction By similarity. |
| Tissue specificity | Only expressed in melanomas. Weakly expressed in normal melanocytes and benign nevi. Highly expressed at the transition from radial growth phase to vertical growth phase and metastatic melanomas, when tumor cells acquire migratory competence and invasive potential. Ref.1 |
| Post-translational modification | Phosphorylated; the phosphorylation is enhanced by EGF. Phosphorylation at Tyr-424 is required for the interaction with GRB2. Ref.4 |
| Sequence similarities | Contains 1 PID domain. Contains 1 SH2 domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Cell membrane Membrane Postsynaptic cell membrane Synapse |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | SH2 domain |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | intracellular signal transduction Inferred from electronic annotation. Source: InterPro |
| Cellular_component | cell junction Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-KW postsynaptic membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6S5L8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6S5L8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-243: Missing. 244-280: KFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQ → MLPALEHWIPKFFSFRTRTGSPLSLACRQPIVGPCDH | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 630 | 630 | SHC-transforming protein 4 | PRO_0000337200 | |||||
Regions | |||||||||
| Domain | 186 – 369 | 184 | PID | ||||||
| Domain | 526 – 617 | 92 | SH2 | ||||||
| Region | 1 – 185 | 185 | CH2 | ||||||
| Region | 370 – 525 | 156 | CH1 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 424 | 1 | Phosphotyrosine | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 243 | 243 | Missing in isoform 2. | VSP_033965 | |||||
| Alternative sequence | 244 – 280 | 37 | KFLST…LDNQQ → MLPALEHWIPKFFSFRTRTG SPLSLACRQPIVGPCDH in isoform 2. | VSP_033966 | |||||
| Natural variant | 52 | 1 | N → D. Ref.3 Corresponds to variant rs17856991 [ dbSNP | Ensembl ]. | VAR_043672 | |||||
| Natural variant | 244 | 1 | K → E. Ref.3 Corresponds to variant rs17856990 [ dbSNP | Ensembl ]. | VAR_043673 | |||||
| Natural variant | 400 | 1 | Q → H. Corresponds to variant rs16961728 [ dbSNP | Ensembl ]. | VAR_043674 | |||||
| Natural variant | 447 | 1 | D → G. Ref.3 Corresponds to variant rs17856992 [ dbSNP | Ensembl ]. | VAR_043675 | |||||
Experimental info | |||||||||
| Mutagenesis | 315 | 1 | R → Q: Phosphorylation is markedly decreased. Completely reduces the phosphorylation and interaction with MUSK; when associated with K-549. Ref.4 | ||||||
| Mutagenesis | 374 – 375 | 2 | YY → F: Remains phosphorylated. Contains a residual phosphorylation; when associated with F-465. Retains the ability to bind MUSK. Reduced the phosphorylation in presence of MUSK; when associated with F-424 and F-465. Completely abolishes the phosphorylation in presence of MUSK; when associated with F-403; F-413; F-424 and F-465. Retains the ability to bind MUSK; when associated with F-465. Retains the ability to bind MUSK; when associated with F-424 and F-465. Retains the ability to bind MUSK; when associated with F-403; F-413; F-424 and F-465. Ref.4 | ||||||
| Mutagenesis | 403 | 1 | Y → F: Completely abolishes the phosphorylation in presence of MUSK; when associated with 374-F-F-375; F-413; F-424 and F-465. Ref.4 | ||||||
| Mutagenesis | 413 | 1 | Y → F: Completely abolishes the phosphorylation in presence of MUSK; when associated with 374-F-F-375; F-403; F-424 and F-465. Ref.4 | ||||||
| Mutagenesis | 424 | 1 | Y → F: Significantly decreased GRB2 interaction. Reduced the phosphorylation in presence of MUSK; when associated with 374-F-F-375 and F-465. Completely abolishes the phosphorylation in presence of MUSK; when associated with 374-F-F-375; F-403; F-413 and F-465. Ref.4 | ||||||
| Mutagenesis | 465 | 1 | Y → F: Remains phosphorylated. Contains a residual phosphorylation; when associated with 374-F-F-375. Reduced the phosphorylation in presence of MUSK; when associated with 374-F-F-375 and 424. Completely abolishes the phosphorylation in presence of MUSK; when associated with 374-F-F-375; F-403; F-413 and F-424. Retains the ability to bind MUSK. Retains the ability to bind MUSK; when associated with 374-F-F-375. Retains the ability to bind MUSK; when associated with 374-F-F-375 and F-424. Retains the ability to bind MUSK; when associated with 374-F-F-375; F-403; F-413 and F-424. Ref.4 | ||||||
| Mutagenesis | 549 | 1 | R → K: Completely reduces the phosphorylation and interaction with MUSK; when associated with Q-315. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "RaLP, a new member of the Src homology and collagen family, regulates cell migration and tumor growth of metastatic melanomas." Fagiani E., Giardina G., Luzi L., Cesaroni M., Quarto M., Capra M., Germano G., Bono M., Capillo M., Pelicci P., Lanfrancone L. Cancer Res. 67:3064-3073(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ASP-52; GLU-244 AND GLY-447. Tissue: Testis. |
| [4] | "Analysis of a Shc family adaptor protein, ShcD/Shc4, that associates with muscle-specific kinase." Jones N., Hardy W.R., Friese M.B., Jorgensen C., Smith M.J., Woody N.M., Burden S.J., Pawson T. Mol. Cell. Biol. 27:4759-4773(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MUSK AND GRB2, PHOSPHORYLATION, MUTAGENESIS OF ARG-315; 374-TYR-TYR-375; TYR-403; TYR-413; TYR-424; TYR-465 AND ARG-549. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY464565 mRNA. Translation: AAR19363.1. AY358250 mRNA. Translation: AAQ88617.1. BC033907 mRNA. Translation: AAH33907.1. |
| IPI | IPI00217895. IPI00747728. |
| RefSeq | NP_976224.3. NM_203349.3. |
| UniGene | Hs.642615. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1OY2 based on UniProtKB P29353. |
| ProteinModelPortal | Q6S5L8. |
| SMR | Q6S5L8. Positions 185-377, 520-619. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000329668. |
PTM databases | |
| PhosphoSite | Q6S5L8. |
Polymorphism databases | |
| DMDM | 74722804. |
Proteomic databases | |
| PaxDb | Q6S5L8. |
| PRIDE | Q6S5L8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000332408; ENSP00000329668; ENSG00000185634. ENST00000396535; ENSP00000379786; ENSG00000185634. |
| GeneID | 399694. |
| KEGG | hsa:399694. |
| UCSC | uc001zxb.1. human. uc010uey.1. human. |
Organism-specific databases | |
| CTD | 399694. |
| GeneCards | GC15M049115. |
| H-InvDB | HIX0202177. |
| HGNC | HGNC:16743. SHC4. |
| neXtProt | NX_Q6S5L8. |
| PharmGKB | PA142670917. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG315087. |
| HOGENOM | HOG000231974. |
| HOVERGEN | HBG050121. |
| InParanoid | Q6S5L8. |
| KO | K06279. |
| OMA | ISTCSLT. |
| OrthoDB | EOG4GF3DQ. |
| PhylomeDB | Q6S5L8. |
Gene expression databases | |
| ArrayExpress | Q6S5L8. |
| Bgee | Q6S5L8. |
| CleanEx | HS_SHC4. |
| Genevestigator | Q6S5L8. |
Family and domain databases | |
| Gene3D | 2.30.29.30. 1 hit. 3.30.505.10. 1 hit. |
| InterPro | IPR011993. PH_like_dom. IPR006019. PID_domain. IPR006020. PTyr_interaction_dom. IPR000980. SH2. [Graphical view] |
| Pfam | PF00640. PID. 1 hit. PF00017. SH2. 1 hit. [Graphical view] |
| PRINTS | PR00401. SH2DOMAIN. PR00629. SHCPIDOMAIN. |
| SMART | SM00462. PTB. 1 hit. SM00252. SH2. 1 hit. [Graphical view] |
| PROSITE | PS01179. PID. 1 hit. PS50001. SH2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SHC4. human. |
| GenomeRNAi | 399694. |
| NextBio | 105503. |
Entry information
| Entry name | SHC4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6S5L8 Secondary accession number(s): Q6UXQ3, Q8IYW3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
