Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Spermatogenesis-associated protein 8

Gene

SPATA8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Spermatogenesis-associated protein 8
Alternative name(s):
Spermatogenesis-related protein 8
Gene namesi
Name:SPATA8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000185594.4
HGNCiHGNC:28676 SPATA8
MIMi613948 gene
neXtProtiNX_Q6RVD6

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000185594
PharmGKBiPA134977227

Polymorphism and mutation databases

BioMutaiSPATA8
DMDMi74738039

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002784441 – 105Spermatogenesis-associated protein 8Add BLAST105

Proteomic databases

EPDiQ6RVD6
PaxDbiQ6RVD6
PRIDEiQ6RVD6

PTM databases

iPTMnetiQ6RVD6
PhosphoSitePlusiQ6RVD6

Expressioni

Tissue specificityi

Expressed at high levels in adult testis, at moderate levels in sperm and at low levels in fetal testis. Not detected in other tissues.1 Publication

Gene expression databases

BgeeiENSG00000185594
CleanExiHS_SPATA8
ExpressionAtlasiQ6RVD6 baseline and differential
GenevisibleiQ6RVD6 HS

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi126956, 19 interactors
IntActiQ6RVD6, 16 interactors
MINTiQ6RVD6
STRINGi9606.ENSP00000328149

Structurei

3D structure databases

ProteinModelPortaliQ6RVD6
SMRiQ6RVD6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410JHJU Eukaryota
ENOG41117PQ LUCA
GeneTreeiENSGT00390000010718
HOGENOMiHOG000154371
InParanoidiQ6RVD6
OMAiHFSEAMT
OrthoDBiEOG091G0YNV
PhylomeDBiQ6RVD6
TreeFamiTF341258

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6RVD6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPAGMSGAQ DNSCLYQEIA PSFQRLPCPR TSSRHFSEAM TCPCGWRPFK
60 70 80 90 100
GGPGGLKGPV WPAKEENSCS HGRIQRVQRR RVPSASPLIQ KINRRSVLFH

PYCWS
Length:105
Mass (Da):11,727
Last modified:July 5, 2004 - v1
Checksum:i4ED05B470B35E9F1
GO
Isoform 2 (identifier: Q6RVD6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     31-105: TSSRHFSEAM...SVLFHPYCWS → YLMSCPWQFSTPDVGLTPIRLPFLCGKTGMKLQHS

Note: No experimental confirmation available.
Show »
Length:65
Mass (Da):7,175
Checksum:i6D7AD6903056ED33
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02328131 – 105TSSRH…PYCWS → YLMSCPWQFSTPDVGLTPIR LPFLCGKTGMKLQHS in isoform 2. 1 PublicationAdd BLAST75

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY489187 mRNA Translation: AAR39432.1
BC033979 mRNA Translation: AAH33979.1
BC066292 mRNA Translation: AAH66292.1
BC112390 mRNA Translation: AAI12391.1
CCDSiCCDS10376.1 [Q6RVD6-1]
RefSeqiNP_001291733.1, NM_001304804.1
NP_001291734.1, NM_001304805.1
NP_001291735.1, NM_001304806.1
NP_775770.1, NM_173499.4 [Q6RVD6-1]
UniGeneiHs.326528

Genome annotation databases

EnsembliENST00000328504; ENSP00000328149; ENSG00000185594 [Q6RVD6-1]
GeneIDi145946
KEGGihsa:145946
UCSCiuc002bue.4 human [Q6RVD6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSPAT8_HUMAN
AccessioniPrimary (citable) accession number: Q6RVD6
Secondary accession number(s): Q2KJ07
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: July 5, 2004
Last modified: February 28, 2018
This is version 89 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health