Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Spermatogenesis-associated protein 8

Gene

SPATA8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Spermatogenesis-associated protein 8
Alternative name(s):
Spermatogenesis-related protein 8
Gene namesi
Name:SPATA8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:28676. SPATA8.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134977227.

Polymorphism and mutation databases

BioMutaiSPATA8.
DMDMi74738039.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 105105Spermatogenesis-associated protein 8PRO_0000278444Add
BLAST

Proteomic databases

PaxDbiQ6RVD6.
PRIDEiQ6RVD6.

PTM databases

iPTMnetiQ6RVD6.
PhosphoSiteiQ6RVD6.

Expressioni

Tissue specificityi

Expressed at high levels in adult testis, at moderate levels in sperm and at low levels in fetal testis. Not detected in other tissues.1 Publication

Gene expression databases

BgeeiENSG00000185594.
CleanExiHS_SPATA8.
ExpressionAtlasiQ6RVD6. baseline and differential.
GenevisibleiQ6RVD6. HS.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ADAMTSL4Q6UY14-33EBI-8635958,EBI-10173507
CMTM5Q96DZ93EBI-8635958,EBI-2548702
GOPCQ9HD263EBI-8635958,EBI-349832
KRTAP10-7P604093EBI-8635958,EBI-10172290
KRTAP10-9P604113EBI-8635958,EBI-10172052
KRTAP9-2Q9BYQ43EBI-8635958,EBI-1044640
MDFIQ997503EBI-8635958,EBI-724076
MTUS2Q5JR593EBI-8635958,EBI-742948
NOTCH2NLQ7Z3S93EBI-8635958,EBI-945833
PLSCR1O151623EBI-8635958,EBI-740019
PSMA3P257883EBI-8635958,EBI-348380
RBPMSQ930624EBI-8635958,EBI-740322

Protein-protein interaction databases

BioGridi126956. 19 interactions.
IntActiQ6RVD6. 12 interactions.
STRINGi9606.ENSP00000328149.

Structurei

3D structure databases

ProteinModelPortaliQ6RVD6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410JHJU. Eukaryota.
ENOG41117PQ. LUCA.
GeneTreeiENSGT00390000010718.
HOGENOMiHOG000154371.
InParanoidiQ6RVD6.
OMAiHFSEAMT.
OrthoDBiEOG091G0YNV.
PhylomeDBiQ6RVD6.
TreeFamiTF341258.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6RVD6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPAGMSGAQ DNSCLYQEIA PSFQRLPCPR TSSRHFSEAM TCPCGWRPFK
60 70 80 90 100
GGPGGLKGPV WPAKEENSCS HGRIQRVQRR RVPSASPLIQ KINRRSVLFH

PYCWS
Length:105
Mass (Da):11,727
Last modified:July 5, 2004 - v1
Checksum:i4ED05B470B35E9F1
GO
Isoform 2 (identifier: Q6RVD6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     31-105: TSSRHFSEAM...SVLFHPYCWS → YLMSCPWQFSTPDVGLTPIRLPFLCGKTGMKLQHS

Note: No experimental confirmation available.
Show »
Length:65
Mass (Da):7,175
Checksum:i6D7AD6903056ED33
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei31 – 10575TSSRH…PYCWS → YLMSCPWQFSTPDVGLTPIR LPFLCGKTGMKLQHS in isoform 2. 1 PublicationVSP_023281Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY489187 mRNA. Translation: AAR39432.1.
BC033979 mRNA. Translation: AAH33979.1.
BC066292 mRNA. Translation: AAH66292.1.
BC112390 mRNA. Translation: AAI12391.1.
CCDSiCCDS10376.1. [Q6RVD6-1]
RefSeqiNP_001291733.1. NM_001304804.1.
NP_001291734.1. NM_001304805.1.
NP_001291735.1. NM_001304806.1.
NP_775770.1. NM_173499.4. [Q6RVD6-1]
UniGeneiHs.326528.

Genome annotation databases

EnsembliENST00000328504; ENSP00000328149; ENSG00000185594. [Q6RVD6-1]
GeneIDi145946.
KEGGihsa:145946.
UCSCiuc002bue.4. human. [Q6RVD6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY489187 mRNA. Translation: AAR39432.1.
BC033979 mRNA. Translation: AAH33979.1.
BC066292 mRNA. Translation: AAH66292.1.
BC112390 mRNA. Translation: AAI12391.1.
CCDSiCCDS10376.1. [Q6RVD6-1]
RefSeqiNP_001291733.1. NM_001304804.1.
NP_001291734.1. NM_001304805.1.
NP_001291735.1. NM_001304806.1.
NP_775770.1. NM_173499.4. [Q6RVD6-1]
UniGeneiHs.326528.

3D structure databases

ProteinModelPortaliQ6RVD6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126956. 19 interactions.
IntActiQ6RVD6. 12 interactions.
STRINGi9606.ENSP00000328149.

PTM databases

iPTMnetiQ6RVD6.
PhosphoSiteiQ6RVD6.

Polymorphism and mutation databases

BioMutaiSPATA8.
DMDMi74738039.

Proteomic databases

PaxDbiQ6RVD6.
PRIDEiQ6RVD6.

Protocols and materials databases

DNASUi145946.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328504; ENSP00000328149; ENSG00000185594. [Q6RVD6-1]
GeneIDi145946.
KEGGihsa:145946.
UCSCiuc002bue.4. human. [Q6RVD6-1]

Organism-specific databases

CTDi145946.
GeneCardsiSPATA8.
HGNCiHGNC:28676. SPATA8.
MIMi613948. gene.
neXtProtiNX_Q6RVD6.
PharmGKBiPA134977227.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JHJU. Eukaryota.
ENOG41117PQ. LUCA.
GeneTreeiENSGT00390000010718.
HOGENOMiHOG000154371.
InParanoidiQ6RVD6.
OMAiHFSEAMT.
OrthoDBiEOG091G0YNV.
PhylomeDBiQ6RVD6.
TreeFamiTF341258.

Miscellaneous databases

ChiTaRSiSPATA8. human.
GenomeRNAii145946.
PROiQ6RVD6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185594.
CleanExiHS_SPATA8.
ExpressionAtlasiQ6RVD6. baseline and differential.
GenevisibleiQ6RVD6. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiSPAT8_HUMAN
AccessioniPrimary (citable) accession number: Q6RVD6
Secondary accession number(s): Q2KJ07
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: July 5, 2004
Last modified: September 7, 2016
This is version 80 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.